KEGG   Mus musculus (mouse): 19013Help
Entry
19013             CDS       T01002                                 

Gene name
Ppara, 4933429D07Rik, AW742785, Nr1c1, PPAR-alpha, PPARalpha, Ppar
Definition
(RefSeq) peroxisome proliferator activated receptor alpha
  KO
K07294  peroxisome proliferator-activated receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04024  cAMP signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    19013 (Ppara)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    19013 (Ppara)
   04920 Adipocytokine signaling pathway
    19013 (Ppara)
   03320 PPAR signaling pathway
    19013 (Ppara)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    19013 (Ppara)
   04931 Insulin resistance
    19013 (Ppara)
  09172 Infectious disease: viral
   05160 Hepatitis C
    19013 (Ppara)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mmu03000]
    19013 (Ppara)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mmu03310]
    19013 (Ppara)
Transcription factors [BR:mmu03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone-like
    19013 (Ppara)
Nuclear receptors [BR:mmu03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   19013 (Ppara)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep
Motif
Other DBs
NCBI-GeneID: 19013
NCBI-ProteinID: NP_001106889
MGI: 104740
Ensembl: ENSMUSG00000022383
Vega: OTTMUSG00000023590
UniProt: P23204 Q542P9
Position
15 E2; 15 40.42 cM
AA seq 468 aa AA seqDB search
MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSIGEESSGSFGFADYQYLGSC
PGSEGSVITDTLSPASSPSSVSCPVIPASTDESPGSALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDLKDSETADLKSLGKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV
IHDMETLCMAEKTLVAKMVANGVEDKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT
FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggtggacacagagagccccatctgtcctctctccccactggaggcagatgacctggaa
agtcccttatctgaagaattcttacaagaaatgggaaacattcaagagatttctcagtcc
atcggtgaggagagctctggaagctttggttttgcagactaccagtacttaggaagctgt
ccgggctccgagggctctgtcatcacagacaccctctctccagcttccagcccttcctca
gtcagctgccccgtgatccccgccagcacggacgagtcccccggcagtgccctgaacatc
gagtgtcgaatatgtggggacaaggcctcagggtaccactacggagttcacgcatgtgaa
ggctgtaagggcttctttcggcgaactattcggctgaagctggtgtacgacaagtgtgat
cggagctgcaagattcagaagaagaaccggaacaaatgccagtactgccgttttcacaag
tgcctgtctgtcgggatgtcacacaatgcaattcgctttggaagaatgccaagatctgaa
aaagcaaaactgaaagcagaaattcttacctgtgaacacgacctgaaagattcggaaact
gcagacctcaaatctctgggcaagagaatccacgaagcctacctgaagaacttcaacatg
aacaaggtcaaggcccgggtcatactcgcgggaaagaccagcaacaacccgccttttgtc
atacatgacatggagaccttgtgtatggccgagaagacgcttgtggccaagatggtggcc
aacggcgtcgaagacaaagaggcagaggtccgattcttccactgctgccagtgcatgtcc
gtggagaccgtcacggagctcacagaatttgccaaggctatcccaggctttgcaaacttg
gacttgaacgaccaagtcaccttgctaaagtacggtgtgtatgaagccatcttcacgatg
ctgtcctccttgatgaacaaagacgggatgctgatcgcgtacggcaatggctttatcaca
cgcgagttccttaagaacctgaggaagccgttctgtgacatcatggaacccaagtttgac
ttcgctatgaagttcaatgccttagaactggatgacagtgacatttccctgtttgtggct
gctataatttgctgtggagatcggcctggccttctaaacataggctacattgagaagttg
caggaggggattgtgcacgtgcttaagctccacctgcagagcaaccatccagatgacacc
ttcctcttcccaaagctccttcaaaaaatggtggaccttcggcagctggtcacggagcat
gcgcagctcgtacaggtcatcaagaagaccgagtccgacgcagcgctgcacccactgttg
caagagatctacagagacatgtactga

DBGET integrated database retrieval system