KEGG   Mus musculus (mouse): 19023
Entry
19023             CDS       T01002                                 

Gene name
Ppef2
Definition
(RefSeq) protein phosphatase, EF hand calcium-binding domain 2
  KO
K13807  serine/threonine-protein phosphatase with EF-hands [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19023 (Ppef2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19023 (Ppef2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   PPEF/PP7 protein phosphatases
    19023 (Ppef2)
SSDB
Motif
Pfam: Metallophos EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_7 EF-hand_5 PPP5 IQ
Other DBs
NCBI-GeneID: 19023
NCBI-ProteinID: NP_035278
MGI: 1342304
Ensembl: ENSMUSG00000029410
Vega: OTTMUSG00000055589
UniProt: O35385
Position
5; 5 E2
AA seq 757 aa
MGSSSSTQHHFAFQNAEKAFKAAALIQRWYRRYMARLEMRRRCTWNIFQSIEYAGQQDQV
KLHEFFSYLVDHFTPSSHHERDFLNRMFTEERFAQDVETEEGGDFESIEVPDSYTGPRLS
FPLLPDHATALVEAFRLRQQLHARYVLNLLYETRKHLAQLPNINRVSTCYSEEVTVCGDL
HGQLDDLIFIFYKNGLPSPERAYVFNGDFVDRGKDSVEVLMVLFAFMLVYPKEFHLNRGN
HEDHLVNLRYGFTKEVMHKYKIHGKKILRTLQDVFCWLPLATLVDEKVLVLHGGVSDKTD
LELLAKLDRHKIVSTMRCKTRKESENREEQKRKDNQTSSGQKPTPWFLPQSRSLPSSPFH
LGSGFKAYKAGRSCSIPCGSPNSKELSRRGQVRRSVDLELEQCRQQAGFLGIREKGESLP
LAPDADCVADGGGVLEPTPEEWKQVVDILWSDPAAQEGCKANAVRGGGCYFGPDVTERLM
EKYKLQLLIRSHECKPEGYEFCHNRKVLTIFSASNYYEVGSNRGAYVKLGPALTPHIVQY
QANKATHRLTMRQRISRVEESALRALRQKLFAHSSDLLVEFRKRDPDESGVITLSDWATA
VESVLHLGLPWRMLRPQLVNSSADNVLEYRSWLDSLAKEQLSRENIQSSLLEKLYRNRSN
LETIFRIIDSDHSGFISLDEFRQTWKLFSSHMSIDITDDGICDLARSIDFNKDGHIDINE
FLEAFRLVEQSCLEGHASACLQSTDTAESGHSSPGPC
NT seq 2274 nt   +upstreamnt  +downstreamnt
atgggaagcagctcatccacccagcaccactttgcgtttcagaacgctgagaaagccttc
aaggcagcggccctgatccagagatggtaccggcgctacatggcccgcctagagatgagg
aggcgatgtacctggaacatcttccagtctatagagtatgctggacagcaagaccaggtc
aagctccatgaattcttcagctaccttgtggaccatttcactcccagcagccaccatgag
agagatttcctgaaccgcatgttcaccgaagagagattcgcccaggacgtggagacagag
gagggtggagattttgaatccatagaggtgccagacagctacacggggccacgcctctcc
ttcccccttcttcctgaccatgccactgccctggtggaagctttcaggctgcgacaacag
ctccatgctcgatacgtcttgaatcttctgtacgagaccagaaaacacctggcccagctg
cccaacatcaaccgagtctccacctgctacagcgaggaggtcacagtgtgtggagatcta
catggccagttggatgatttaatatttatattttataagaacggtctaccatcaccagag
agagcatacgtgttcaatggtgactttgtggatcgaggcaaggactctgtagaggtcctg
atggttctctttgccttcatgttggtataccccaaggagttccatcttaacagaggaaac
catgaggaccatctagtgaacctacgatatggcttcaccaaggaagtgatgcataaatac
aagatacatgggaagaaaatcctaaggacacttcaggatgtcttctgctggcttccgttg
gccactctggttgatgagaaagtccttgttcttcatggtggagtctcagacaagacagac
ctggaacttctggctaaactagacaggcacaagattgtttctaccatgaggtgcaaaaca
agaaaggaaagtgagaatcgagaggagcagaagagaaaagataaccagacaagctctgga
cagaaacctactccgtggtttcttcctcaaagccgctctctgccctcttcgccttttcac
ctgggctctggctttaaggcctacaaagccggcaggtcctgcagcatcccctgtggctcc
cctaacagcaaggagctatcccggcgggggcaggtgcggcgctcagtggacctggaactg
gaacagtgccggcagcaagccggcttcctggggatcagagagaagggggagtccttgcct
ttggccccagatgctgactgtgttgctgatgggggaggggtgctggaacccacccccgag
gagtggaagcaggttgtagatattctgtggagtgatcccgcggctcaggagggctgcaag
gccaacgctgtccgaggaggaggctgttactttgggcctgacgtgacagaacggttgatg
gaaaaatacaagctgcaactcctgatccgttcgcatgagtgcaaacccgagggctatgag
ttctgtcacaaccgcaaggtgttaaccatcttttctgcctccaactactatgaagttggc
agcaacagaggagcctacgtcaagctggggccagccctgactccacatatcgtgcagtat
caagctaacaaggcgacccacaggctaaccatgaggcaaaggatcagcagggtggaggag
tcggccctcagagcccttcgacagaaattatttgctcattcgtcggacctgcttgttgag
tttaggaagcgcgacccggatgagagcggtgtcatcaccctgagtgattgggcgactgcc
gtggagtctgtgctgcacctgggactgccctggcggatgctgcggccacaactggtgaat
agttcagcggataacgtgttggaatacaggtcctggttggacagtttggccaaagaacag
ctgagccgagagaatattcagtcgagtttgctggaaaagctctatcgaaaccgatccaac
ttggagaccatttttaggatcatagacagcgatcattcaggattcatctccctggatgag
ttcaggcagacttggaagctcttcagctcacatatgagcatcgacatcacagatgacggc
atctgtgacctcgccagaagcatcgacttcaacaaggatggccacatcgacatcaatgag
ttcctggaggccttccgcctcgtggagcagtcctgcttagagggccacgcctctgcttgc
ctgcagtccacagacactgctgagagtggccatagcagtccaggcccatgctga

DBGET integrated database retrieval system