KEGG   Mus musculus (mouse): 19027
Entry
19027             CDS       T01002                                 

Symbol
Sypl, AI314763, AI604763, D12Ertd446e, PanI, Pphn, Sypl1
Name
(RefSeq) synaptophysin-like protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: MARVEL
Other DBs
NCBI-GeneID: 19027
NCBI-ProteinID: NP_038663
MGI: 108081
Ensembl: ENSMUSG00000020570
Vega: OTTMUSG00000027537
UniProt: O09117
Position
12:33003874..33029503
AA seq 261 aa
MASKANMVRQRFSRLSQRMSAFQINLNPLKEPLGFIKILEWFASIFAFATCGGFKGKTEI
QVNCPKVGVNKNQTVTATFGYPFRLNQASFHTPPNVSVCDVNWEKHVLIGDYSSSAQFYV
TFAVFVFLYCIAALLLYVGYTNLYRDSRKLPMIDFIVTLVATFLWLVSSSAWAKALTDIK
VATGHRIVEELEICNPESGVSCYFVSVTSMGSLNVSVIFGFLNMILWGGNAWFVYKETSL
HSPSNTSASHSQGGGPPTSGM
NT seq 786 nt   +upstreamnt  +downstreamnt
atggcttccaaagccaacatggttcgtcagcggttcagccggctgagtcagaggatgtcc
gccttccagatcaacctcaacccgctcaaggagccgctcggcttcatcaagatcctcgag
tggtttgcctccatctttgcttttgccacctgtggtgggtttaagggcaaaacagaaatt
caagtgaactgtcctaaagttggtgtcaataagaaccagactgtgacagctacttttggt
tatccattcaggttgaatcaggcatcatttcatacacctccaaatgtcagtgtgtgtgac
gtgaactgggaaaagcatgttctcataggtgattactcctcttctgcacagttctacgtt
acgtttgcagtctttgtgttcctgtactgcattgctgcccttctgctctatgttggttac
acgaacctctaccgggatagtcgcaaactgcccatgatcgactttattgttactcttgtt
gctacttttttgtggttggtgagttcctcagcctgggctaaagctcttacagatattaaa
gtagctactggacacagaattgtggaggaacttgaaatttgtaatccagaatcaggagtg
tcatgttactttgtctctgtgactagtatgggctccctgaatgtatccgtgatctttggc
tttctgaatatgatactttggggaggaaatgcttggtttgtgtacaaggagaccagctta
cacagtccgtcaaatacgtcagcttcccacagccaaggcggtggcccacccacttctgga
atgtaa

DBGET integrated database retrieval system