KEGG   Mus musculus (mouse): 19035Help
Entry
19035             CDS       T01002                                 

Gene name
Ppib, AA408962, AA553318, AI844835, Cphn-2, Cphn2, CyP-20b
Definition
(RefSeq) peptidylprolyl isomerase B
  KO
K03768  peptidyl-prolyl cis-trans isomerase B (cyclophilin B) [EC:5.2.1.8]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:mmu03110]
    19035 (Ppib)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     19035 (Ppib)
Chaperones and folding catalysts [BR:mmu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    19035 (Ppib)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 19035
NCBI-ProteinID: NP_035279
MGI: 97750
Ensembl: ENSMUSG00000032383
Vega: OTTMUSG00000062641
UniProt: P24369 Q9DCY1
Position
9; 9 C
AA seq 216 aa AA seqDB search
MLRLSERNMKVLFAAALIVGSVVFLLLPGPSVANDKKKGPKVTVKVYFDLQIGDESVGRV
VFGLFGKTVPKTVDNFVALATGEKGFGYKNSKFHRVIKDFMIQGGDFTRGDGTGGKSIYG
ERFPDENFKLKHYGPGWVSMANAGKDTNGSQFFITTVKTSWLDGKHVVFGKVLEGMDVVR
KVESTKTDSRDKPLKDVIIVDSGKIEVEKPFAIAKE
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgcctctcggagcgcaatatgaaggtgctcttcgccgccgccctcatcgtgggc
tccgtcgtcttccttttgctgcccggaccctccgtggccaacgataagaagaagggacct
aaagtcacagtcaaggtatactttgatttacaaattggagatgaatctgtaggacgagtc
gtctttggactctttggaaagactgttccaaaaacagtggataattttgtagccttagct
acaggagagaaaggatttggctacaaaaacagcaagttccatcgtgtcatcaaggacttc
atgatccagggtggagacttcaccaggggagatggcacaggaggaaagagcatctatggt
gagcgcttcccagatgagaacttcaagctgaagcactacgggcctggctgggtgagcatg
gccaatgcaggcaaagacaccaatggctcacagttcttcataaccacagtcaagacctcc
tggctggatggcaagcatgtggttttcggcaaagttctagagggcatggatgtggtacgg
aaggtggagagcaccaagacagacagccgggacaagccactgaaggatgtcatcattgtc
gactccggcaagatcgaagtggagaaacccttcgccattgccaaggagtag

DBGET integrated database retrieval system