KEGG   Mus musculus (mouse): 19042Help
Entry
19042             CDS       T01002                                 

Gene name
Ppm1a, 2310003C21Rik, 2900017D14Rik, AI427932, AU017636, MMPa-2, MPPa-1
Definition
(RefSeq) protein phosphatase 1A, magnesium dependent, alpha isoform
  KO
K04457  protein phosphatase 1A [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19042 (Ppm1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19042 (Ppm1a)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19042 (Ppm1a)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    19042 (Ppm1a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C PP2C_C
Motif
Other DBs
NCBI-GeneID: 19042
NCBI-ProteinID: NP_032936
MGI: 99878
Ensembl: ENSMUSG00000021096
UniProt: P49443 Q9EQE3
Position
12; 12 C3
AA seq 382 aa AA seqDB search
MGAFLDKPKMEKHNAQGQGNGLRYGLSSMQGWRVEMEDAHTAVIGLPSGLETWSFFAVYD
GHAGSQVAKYCCEHLLDHITNNQDFRGSAGAPSVENVKNGIRTGFLEIDEHMRVMSEKKH
GADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRKVHFFTQDHKPSNPLEKERIQNAGG
SVMIQRVNGSLAVSRALGDFDYKCVHGKGPTEQLVSPEPEVHDIERSEEDDQFIILACDG
IWDVMGNEELCDFVRSRLEVTDDLEKVCNEVVDTCLYKGSRDNMSVILICFPSAPKVSAE
AVKKEAELDKYLESRVEEIIKKQVEGVPDLVHVMRTLASENIPSLPPGGELASKRNVIEA
VYNRLNPYKNDDTDSASTDDMW
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgggagcatttttagacaagccaaagatggagaagcataatgcccaggggcaggggaat
gggttacgatacggcctaagcagcatgcaaggttggcgagttgaaatggaggacgcacac
acggctgtgatcggtttgccaagtggacttgagacatggtcattctttgctgtatatgat
gggcatgctggttctcaggttgccaaatactgctgtgagcacttgttagatcacatcacc
aataaccaggatttcagaggatctgcaggagcaccttctgtggagaacgtaaagaatgga
atcagaacagggtttctggagattgatgaacacatgagagttatgtcagagaagaaacat
ggtgcagatagaagcgggtcaacagctgtgggcgtcttaatctctccccaacatacttat
ttcattaactgtggagactcgagaggtttactttgtaggaatagaaaagttcacttcttc
acacaagaccataaaccaagtaacccgctggaaaaagaacgaattcagaatgcagggggc
tcggtgatgattcagcgtgtcaatggctctctggctgtatcgagggcccttggggatttc
gattacaaatgtgtccatggaaaaggtcccacagagcagcttgtctccccagagcccgaa
gtccatgatattgaaaggtctgaagaagatgaccagttcatcatccttgcatgcgatggc
atctgggacgtcatggggaacgaagagctctgtgactttgtgagatccagacttgaagtc
actgatgaccttgagaaagtttgcaatgaagtagtcgacacctgcttgtataagggaagt
cgagacaacatgagtgtgattttgatctgttttccaagtgcacccaaagtctcggcagag
gcggtgaagaaggaggcggagctggacaagtacctggagagcagagtagaagaaatcata
aagaagcaggtggaaggcgtccctgacttagtccacgtgatgcgcacgttagccagtgag
aacatccccagcctcccaccagggggtgaattggcaagcaagcggaatgtaattgaagcc
gtttacaatagactgaacccttacaaaaatgacgacactgattctgcgtcaaccgatgat
atgtggtaa

DBGET integrated database retrieval system