KEGG   Mus musculus (mouse): 19043Help
Entry
19043             CDS       T01002                                 

Gene name
Ppm1b, PP2CB
Definition
(RefSeq) protein phosphatase 1B, magnesium dependent, beta isoform
  KO
K04461  protein phosphatase 1B [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19043 (Ppm1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19043 (Ppm1b)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19043 (Ppm1b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    19043 (Ppm1b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP2C PP2C_C PP2C_2
Motif
Other DBs
NCBI-GeneID: 19043
NCBI-ProteinID: NP_001152969
MGI: 101841
Ensembl: ENSMUSG00000061130
UniProt: P36993
Position
17 E4; 17 55.13 cM
AA seq 390 aa AA seqDB search
MGAFLDKPKTEKHNAHGAGNGLRYGLSSMQGWRVEMEDAHTAVVGIPHGLDNWSFFAVYD
GHAGSRVANYCSTHLLEHITTNEDFRAADKSGSALEPSVESVKTGIRTGFLKIDEYMRNF
SDLRNGMDRSGSTAVGVMVSPTHMYFINCGDSRAVLCRNGQVCFSTQDHKPCNPVEKERI
QNAGGSVMIQRVNGSLAVSRALGDYDYKCVDGKGPTEQLVSPEPEVYEIVRAEEDEFVVL
ACDGIWDVMSNEELCEFVKSRLEVSDDLENVCNWVVDTCLHKGSRDNMSVVLVCFSNAPK
VSEEAVKRDSELDKHLESRVEEIMQKSGEEGMPDLAHVMRILSAENIPNLPPGGGLAGKR
HVIEAVYSRLNPHKDNDGMADLSTSICKPS
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgggtgcatttttggataaacccaaaactgaaaagcacaatgctcacggtgctgggaat
ggtctgcgttatggcctgagcagtatgcaaggatggagagtagaaatggaagatgcacac
acagctgttgtgggtattcctcacggcttggacaactggtcgttttttgcagtttatgac
ggtcatgctggatcccgagtggcaaattactgttcaacacatctattagaacacatcacc
accaatgaagacttcagggcagctgacaaatcaggctctgctctcgagccttcagtagaa
agtgtgaagactggtatcaggactggctttttgaaaattgatgaatatatgcgtaacttc
tcagacctgaggaacgggatggacaggagcggctcgactgcagtgggcgtgatggtctcc
cctacacacatgtacttcatcaactgtggtgactctcgagctgttctgtgtaggaacgga
caggtctgcttttctacccaggatcacaaaccttgtaatccagtggagaaggagcgcatc
caaaacgcaggaggcagtgtgatgatccagcgtgtgaacggctcactagcagtgtctcgg
gctctgggggactatgactacaagtgtgtggatggcaagggccctacagagcagcttgtt
tctccagagcctgaggtttatgagattgtgagagcagaagaggatgagtttgtcgtcttg
gcctgtgatgggatctgggatgtgatgagcaatgaggagctctgtgagtttgttaagtct
aggcttgaggtgtcggacgacctggagaatgtgtgcaattgggtagtggacacttgttta
cataagggaagtcgagataacatgagtgttgtattagtttgcttttcaaatgcccccaag
gtctcagaggaagccgtgaagagagattcagagttggataagcacttggaatcacgggtt
gaagaaatcatgcagaagtctggggaggaaggaatgcctgatcttgcccatgtgatgcgc
attttgtctgcagaaaatatcccgaatttacctcccgggggaggtctcgctggcaagcgc
catgttattgaagctgtttatagtagacttaatccacacaaagacaatgatgggatggca
gacttgagcacgtctatttgtaaacccagctga

DBGET integrated database retrieval system