KEGG   Mus musculus (mouse): 19047Help
Entry
19047             CDS       T01002                                 

Gene name
Ppp1cc, PP-1G, PP1, dis2m1
Definition
(RefSeq) protein phosphatase 1 catalytic subunit gamma
  KO
K06269  serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04022  cGMP-PKG signaling pathway
mmu04024  cAMP signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04270  Vascular smooth muscle contraction
mmu04390  Hippo signaling pathway
mmu04510  Focal adhesion
mmu04611  Platelet activation
mmu04720  Long-term potentiation
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04810  Regulation of actin cytoskeleton
mmu04910  Insulin signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04931  Insulin resistance
mmu05031  Amphetamine addiction
mmu05034  Alcoholism
mmu05168  Herpes simplex infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    19047 (Ppp1cc)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    19047 (Ppp1cc)
   04024 cAMP signaling pathway
    19047 (Ppp1cc)
   04022 cGMP-PKG signaling pathway
    19047 (Ppp1cc)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    19047 (Ppp1cc)
   04218 Cellular senescence
    19047 (Ppp1cc)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19047 (Ppp1cc)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    19047 (Ppp1cc)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    19047 (Ppp1cc)
  09152 Endocrine system
   04910 Insulin signaling pathway
    19047 (Ppp1cc)
   04921 Oxytocin signaling pathway
    19047 (Ppp1cc)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    19047 (Ppp1cc)
   04270 Vascular smooth muscle contraction
    19047 (Ppp1cc)
  09156 Nervous system
   04728 Dopaminergic synapse
    19047 (Ppp1cc)
   04720 Long-term potentiation
    19047 (Ppp1cc)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    19047 (Ppp1cc)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    19047 (Ppp1cc)
  09165 Substance dependence
   05031 Amphetamine addiction
    19047 (Ppp1cc)
   05034 Alcoholism
    19047 (Ppp1cc)
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    19047 (Ppp1cc)
  09172 Infectious diseases: Viral
   05168 Herpes simplex infection
    19047 (Ppp1cc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19047 (Ppp1cc)
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:mmu03021]
    19047 (Ppp1cc)
   03019 Messenger RNA biogenesis [BR:mmu03019]
    19047 (Ppp1cc)
   03041 Spliceosome [BR:mmu03041]
    19047 (Ppp1cc)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19047 (Ppp1cc)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     19047 (Ppp1cc)
Transcription machinery [BR:mmu03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     19047 (Ppp1cc)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA processing factors
   3' end processing
    Cleavage and polyadenylation specificity factor (CPSF) complex
     19047 (Ppp1cc)
Spliceosome [BR:mmu03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    19047 (Ppp1cc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Metallophos STPPase_N
Motif
Other DBs
NCBI-GeneID: 19047
NCBI-ProteinID: NP_038664
MGI: 104872
Ensembl: ENSMUSG00000004455
Vega: OTTMUSG00000016349
UniProt: P63087 Q6ZWM8
Structure
PDB: 

Position
5; 5 F
AA seq 323 aa AA seqDB search
MADIDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLK
ICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFL
LRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDL
QSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAE
KKKPNATRPVTPPRGMITKQAKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggatatcgacaaactcaacatcgacagcatcatccaacggctgctggaagtgaga
gggtccaagccaggcaagaatgtccagctccaggagaacgagatccgaggactctgcctg
aagtctcgggagatcttcctcagtcagcctatccttttagaacttgaagcaccactcaag
atatgtggtgacatccacgggcagtactatgatttgctccgtctgtttgaatacggtggc
tttcctccagagagcaactatttgtttctcggggactatgtggacaggggcaagcagtcc
ctggagacaatctgcctcttgctggcctacaaaatcaagtatccggagaacttctttctt
ctcagagggaaccacgagtgcgccagcatcaataggatctacggattttatgatgagtgt
aaaagaagatacaacattaagctgtggaaaacgttcacagactgttttaactgcttgccg
atagcagccatcgtggacgagaagatattctgctgtcatggaggtttatcaccagatctt
caatctatggagcagattcggcgaattatgagaccaactgatgtaccagatcaaggtctt
ctttgtgatcttttgtggtctgaccccgataaagatgtcttaggctggggtgaaaatgac
agaggagtgtccttcacatttggtgcagaagtggttgcaaaatttctccataagcatgat
ttggatcttatatgtagagcccatcaggtggttgaagatggctatgagttttttgcaaag
aggcagttagtcactctgttttctgcacccaactactgtggcgagtttgacaatgcaggc
gccatgatgagtgtggatgagaccctcatgtgttccttccagattttaaagcctgcagag
aaaaagaagcccaacgccacgagacctgtcacaccaccacggggtatgatcacaaagcaa
gcaaagaaatag

DBGET integrated database retrieval system