KEGG   Mus musculus (mouse): 19052
Entry
19052             CDS       T01002                                 

Gene name
Ppp2ca, P, PP2A, R75353
Definition
(RefSeq) protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu05142  Chagas disease
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    19052 (Ppp2ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    19052 (Ppp2ca)
   04390 Hippo signaling pathway
    19052 (Ppp2ca)
   04071 Sphingolipid signaling pathway
    19052 (Ppp2ca)
   04151 PI3K-Akt signaling pathway
    19052 (Ppp2ca)
   04152 AMPK signaling pathway
    19052 (Ppp2ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    19052 (Ppp2ca)
   04136 Autophagy - other
    19052 (Ppp2ca)
  09143 Cell growth and death
   04114 Oocyte meiosis
    19052 (Ppp2ca)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    19052 (Ppp2ca)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    19052 (Ppp2ca)
  09156 Nervous system
   04728 Dopaminergic synapse
    19052 (Ppp2ca)
   04730 Long-term depression
    19052 (Ppp2ca)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    19052 (Ppp2ca)
   05165 Human papillomavirus infection
    19052 (Ppp2ca)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    19052 (Ppp2ca)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19052 (Ppp2ca)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    19052 (Ppp2ca)
   04131 Membrane trafficking [BR:mmu04131]
    19052 (Ppp2ca)
   03036 Chromosome and associated proteins [BR:mmu03036]
    19052 (Ppp2ca)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19052 (Ppp2ca)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19052 (Ppp2ca)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     19052 (Ppp2ca)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     19052 (Ppp2ca)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    19052 (Ppp2ca)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     19052 (Ppp2ca)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19052 (Ppp2ca)
SSDB
Motif
Pfam: Metallophos STPPase_N Glyco_hydro_65N YqzH
Other DBs
NCBI-GeneID: 19052
NCBI-ProteinID: NP_062284
MGI: 1321159
Ensembl: ENSMUSG00000020349
Vega: OTTMUSG00000005619
UniProt: P63330
Position
11; 11 B1.3
AA seq 309 aa
MDEKLFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYRERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgagaagttgttcaccaaggagctggaccagtggatcgagcagctgaacgagtgc
aagcagctctccgagtcccaggtcaagagcctctgcgagaaggctaaagaaatcctgaca
aaagaatccaacgttcaagaggttcgatgtccagtcactgtgtgtggagatgtacatggg
caatttcatgatctcatggaactctttagaattggtggtaaatcaccagatacaaattac
ctgtttatgggagactatgtggacagaggatattactctgttgaaacagttacactgctt
gtagctcttaaggttcgttaccgagagcgcatcaccatactccgagggaatcacgagagc
agacagatcacacaggtttatgggttctacgacgagtgtttaaggaaatacggaaatgca
aatgtttggaaatacttcacagacctttttgactatcttcctctcactgccttggtggat
gggcagatcttctgtctacacggtggtctgtcaccatccatagacacactggatcacatc
cgagcactcgatcgcctacaggaagttcctcatgagggtccaatgtgtgacttgctgtgg
tcagatccagatgaccgtggtggctgggggatatctcctcggggagctggttataccttt
ggccaagatatttctgagacatttaatcatgccaatggcctcacgttggtgtccagagct
caccagctggtgatggagggatataactggtgccatgaccggaacgtagtaacaattttc
agtgctccaaactattgctatcgttgtggtaaccaagctgcaatcatggaacttgacgac
actcttaagtattctttcttgcagtttgacccagcacctcgtagaggcgagccacatgtc
actcgtcgtaccccagactacttcctgtaa

KEGG   Mus musculus (mouse): 19053
Entry
19053             CDS       T01002                                 

Gene name
Ppp2cb, AI115466, D8Ertd766, D8Ertd766e, PP, PP2Ac
Definition
(RefSeq) protein phosphatase 2 (formerly 2A), catalytic subunit, beta isoform
  KO
K04382  serine/threonine-protein phosphatase 2A catalytic subunit [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04136  Autophagy - other
mmu04140  Autophagy - animal
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu05142  Chagas disease
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    19053 (Ppp2cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    19053 (Ppp2cb)
   04390 Hippo signaling pathway
    19053 (Ppp2cb)
   04071 Sphingolipid signaling pathway
    19053 (Ppp2cb)
   04151 PI3K-Akt signaling pathway
    19053 (Ppp2cb)
   04152 AMPK signaling pathway
    19053 (Ppp2cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    19053 (Ppp2cb)
   04136 Autophagy - other
    19053 (Ppp2cb)
  09143 Cell growth and death
   04114 Oocyte meiosis
    19053 (Ppp2cb)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    19053 (Ppp2cb)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    19053 (Ppp2cb)
  09156 Nervous system
   04728 Dopaminergic synapse
    19053 (Ppp2cb)
   04730 Long-term depression
    19053 (Ppp2cb)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    19053 (Ppp2cb)
   05165 Human papillomavirus infection
    19053 (Ppp2cb)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    19053 (Ppp2cb)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19053 (Ppp2cb)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    19053 (Ppp2cb)
   04131 Membrane trafficking [BR:mmu04131]
    19053 (Ppp2cb)
   03036 Chromosome and associated proteins [BR:mmu03036]
    19053 (Ppp2cb)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19053 (Ppp2cb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19053 (Ppp2cb)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Catalytic subunits
     19053 (Ppp2cb)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     19053 (Ppp2cb)
Membrane trafficking [BR:mmu04131]
 Autophagy
  Other autophagy associated proteins
   Others
    19053 (Ppp2cb)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     19053 (Ppp2cb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19053 (Ppp2cb)
SSDB
Motif
Pfam: Metallophos STPPase_N
Other DBs
NCBI-GeneID: 19053
NCBI-ProteinID: NP_059070
MGI: 1321161
Ensembl: ENSMUSG00000009630
Vega: OTTMUSG00000060960
UniProt: P62715 Q8BN07
Position
8 A4; 8 20.63 cM
AA seq 309 aa
MDDKAFTKELDQWVEQLNECKQLNENQVRTLCEKAKEILTKESNVQEVRCPVTVCGDVHG
QFHDLMELFRIGGKSPDTNYLFMGDYVDRGYYSVETVTLLVALKVRYPERITILRGNHES
RQITQVYGFYDECLRKYGNANVWKYFTDLFDYLPLTALVDGQIFCLHGGLSPSIDTLDHI
RALDRLQEVPHEGPMCDLLWSDPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRA
HQLVMEGYNWCHDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRRGEPHV
TRRTPDYFL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggacgacaaggcgttcaccaaggagctggaccagtgggtggagcagctgaacgagtgt
aagcagctgaacgagaaccaagtgcggacgctgtgcgagaaggctaaggaaattttaacg
aaagaatcaaatgtgcaagaggtccgctgtcctgttaccgtctgtggagatgtgcatggc
caattccatgaccttatggagctcttcagaattggtgggaaatcaccagatacgaactac
ctattcatgggggactatgtagacagagggtactactctgtggagactgtgactcttctt
gtagcattaaaggtgcgctatccagagcgcatcacaatattgcgaggaaatcacgaaagc
cggcagatcacacaagtgtatggcttttatgatgagtgcctacggaagtatggaaatgcc
aacgtgtggaaatactttacagatctctttgattatcttccacttacagctttagtagat
ggacagatattctgcctccacggtggcctgtctccatccatagatacactggaccacata
agagccctggatcgcttgcaagaagttccacatgagggcccaatgtgtgatctcttatgg
tcagatccggatgaccgtggcggctggggcatttctccacgtggtgctggctacacattt
ggacaagacatttctgaaacatttaaccatgccaacggtctcacactggtgtctcgtgct
caccagcttgtaatggaaggatataactggtgccatgatcggaatgtggtcaccattttt
agtgcgcccaattactgctaccgttgtgggaaccaggctgctatcatggaattagatgac
actttaaaatattcatttcttcagtttgacccagcacctcgtcgtggagagcctcatgtg
acccggcgcaccccagactacttcctgtaa

KEGG   Mus musculus (mouse): 269643
Entry
269643            CDS       T01002                                 

Gene name
Ppp2r2c, 6330548O06Rik, IMY, IMYPNO, IMYPNO1, PR, PR52
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, gamma
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu04728  Dopaminergic synapse
mmu05142  Chagas disease
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    269643 (Ppp2r2c)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    269643 (Ppp2r2c)
   04071 Sphingolipid signaling pathway
    269643 (Ppp2r2c)
   04151 PI3K-Akt signaling pathway
    269643 (Ppp2r2c)
   04152 AMPK signaling pathway
    269643 (Ppp2r2c)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    269643 (Ppp2r2c)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    269643 (Ppp2r2c)
  09156 Nervous system
   04728 Dopaminergic synapse
    269643 (Ppp2r2c)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    269643 (Ppp2r2c)
   05165 Human papillomavirus infection
    269643 (Ppp2r2c)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    269643 (Ppp2r2c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    269643 (Ppp2r2c)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    269643 (Ppp2r2c)
   03036 Chromosome and associated proteins [BR:mmu03036]
    269643 (Ppp2r2c)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     269643 (Ppp2r2c)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     269643 (Ppp2r2c)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     269643 (Ppp2r2c)
SSDB
Motif
Pfam: BSMAP
Other DBs
NCBI-GeneID: 269643
NCBI-ProteinID: NP_766582
MGI: 2442660
Ensembl: ENSMUSG00000029120
Vega: OTTMUSG00000022772
UniProt: Q8BG02
Position
5; 5 B3
AA seq 447 aa
MGEDTDTRKINHSFLRDHSYVTEADVISTVEFNHTGELLATGDKGGRVVIFQREPESKNA
PHSQGEYDVYSTFQSHEPEFDYLKSLEIEEKINKIKWLPQQNAAHSLLSTNDKTIKLWKI
TERDKRPEGYNLKDEEGKLKDLSTVTSLQVPVLKPMDLMVEVSPRRTFANGHTYHINSIS
VNSDCETYMSADDLRINLWHLAITDRSFNIVDIKPANMEDLTEVITASEFHPHHCNLFVY
SSSKGSLRLCDMRAAALCDKHSKLFEEPEDPSNRSFFSEIISSVSDVKFSHSGRYMLTRD
YLTVKVWDLNMEARPIETYQVHDYLRSKLCSLYESDCIFDKFECAWNGSDSVIMTGAYNN
FFRMFDRNTKRDVTLEASRESSKPRAVLKPRRVCVGGKRRRDDISVDSLDFTKKILHTAW
HPAENIIAIAATNNLYIFQDKVNSDMH
NT seq 1344 nt   +upstreamnt  +downstreamnt
atgggcgaggacacggacacgcggaaaattaaccacagcttcctgcgggaccacagctat
gtgacagaagctgacgtcatctccactgtcgagttcaaccacactggggaactgctcgcc
acaggtgacaagggtggccgggtggttatcttccagcgggaaccagagagtaagaacgca
cctcacagccagggtgagtacgatgtatacagcaccttccagagccacgagccggagttt
gactacctgaagagcctggagatagaggagaaaatcaacaagatcaaatggctcccgcag
cagaacgccgcgcactcgctgctgtccaccaatgataaaactatcaaattatggaagatt
accgaacgagacaagaggcccgagggctacaacctgaaggatgaggagggaaagctgaag
gacctgtccacggtgacgtcactgcaggtgcctgtgctgaagcccatggacctgatggtg
gaggtgagcccaagaaggacctttgccaatggccacacctaccacatcaactccatctcc
gtcaacagcgactgtgagacgtacatgtcagcggacgacctacgcatcaacctctggcat
ctggccatcactgatcggagcttcaacattgtagacatcaagccagccaacatggaggac
ctcacggaggtgatcacagcatccgagttccatccgcaccactgcaacctcttcgtctac
agcagcagcaagggctccctgcggctctgtgacatgcgggcagctgccttgtgcgacaag
cactccaagctctttgaagagcccgaggaccccagcaaccgctccttcttttcagagatc
atctcctcggtgtccgacgtgaagttcagccacagtgggcgctacatgctcacgagggat
tacctcacggtcaaggtctgggacctgaacatggaggcgaggcccatagagacctaccag
gtccacgactacctgcggagtaagctctgttccctgtatgagagtgactgcatctttgac
aagtttgagtgtgcctggaatgggagtgacagtgtcatcatgacaggggcctacaacaac
ttcttccgcatgttcgaccgtaacaccaagagggacgtgacactggaagcctcgcgggag
agcagcaaacccagagcggtgctcaagccaaggcgcgtgtgtgtgggtggcaagcggcgg
cgtgacgacatcagtgtggacagcttggacttcaccaagaagatcctgcacacggcctgg
cacccagctgagaatatcattgccattgcagccaccaacaacctgtacatcttccaggat
aaggtcaactctgacatgcactag

KEGG   Mus musculus (mouse): 51792
Entry
51792             CDS       T01002                                 

Gene name
Ppp2r1a, 6330556D22Rik, P, PP2A, PR, PR65
Definition
(RefSeq) protein phosphatase 2, regulatory subunit A, alpha
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu05142  Chagas disease
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    51792 (Ppp2r1a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    51792 (Ppp2r1a)
   04390 Hippo signaling pathway
    51792 (Ppp2r1a)
   04071 Sphingolipid signaling pathway
    51792 (Ppp2r1a)
   04151 PI3K-Akt signaling pathway
    51792 (Ppp2r1a)
   04152 AMPK signaling pathway
    51792 (Ppp2r1a)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    51792 (Ppp2r1a)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    51792 (Ppp2r1a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    51792 (Ppp2r1a)
  09156 Nervous system
   04728 Dopaminergic synapse
    51792 (Ppp2r1a)
   04730 Long-term depression
    51792 (Ppp2r1a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    51792 (Ppp2r1a)
   05165 Human papillomavirus infection
    51792 (Ppp2r1a)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    51792 (Ppp2r1a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    51792 (Ppp2r1a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    51792 (Ppp2r1a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    51792 (Ppp2r1a)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     51792 (Ppp2r1a)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     51792 (Ppp2r1a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     51792 (Ppp2r1a)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Cnd1 Adaptin_N CLASP_N TAF6_C M11L Spore_Cse60
Other DBs
NCBI-GeneID: 51792
NCBI-ProteinID: NP_058587
MGI: 1926334
Ensembl: ENSMUSG00000007564
Vega: OTTMUSG00000016281
UniProt: Q76MZ3
Structure
PDB: 
3FGA 2PF4 6EF4 2IAE

Position
17; 17 A3.2
AA seq 589 aa
MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIY
DEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHS
PSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPM
VRRAAASKLGEFAKVLELDNVKSEIIPMFSNLASDEQDSVRLLAVEACVNIAQLLPQEDL
EALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRA
AASHKVKEFCENLSADCRENVIMTQILPCIKELVSDANQHVKSALASVIMGLSPILGKDN
TIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHA
TIIPKVLAMSGDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNV
AKSLQKIGPILDNSTLQSEVKPILEKLTQDQDVDVKYFAQEALTVLSLA
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggcagctgccgacggtgacgattcgctctatcctattgcggtgctcatagatgaactc
cgcaatgaggacgttcagcttcgtctcaatagtatcaagaagctctccacaattgccttg
gcccttggggttgaacggaccagaagtgagctcctgcccttccttacagataccatttat
gatgaagatgaggtcctcttggccttggctgaacagctgggaaccttcacaactttggtg
ggagggcctgagtatgtgcactgtctgctgccaccccttgagtcactggccacagtggaa
gagacagtagtgcgagacaaggcggtagaatccttgcgggccatctctcatgagcactca
ccttccgatctagaggctcactttgtgcctctggtaaagcggctggcgggtggagactgg
ttcacctcccgcacctcggcctgtggtctcttctcagtttgctacccccgagtatccagt
gccgtgaaggcagaacttcgacagtacttccggaacctgtgctcagatgacacccccatg
gtgcggcgggccgctgcctccaagctgggggaatttgccaaggtactggagctggacaat
gtcaagagtgagatcattcccatgttctctaacctggcctctgacgagcaggactcggtg
cggctgctggcagtggaggcatgtgtgaatattgcccagcttctgccacaggaggacctg
gaggccttagtgatgcccaccttgcgacaggctgctgaggacaagtcttggcgtgttcgc
tacatggtggccgacaagttcacagagctccagaaagcagtggggcctgagatcaccaag
acagatctggtgcctgccttccagaacctgatgaaggactgtgaggccgaggtgagggcc
gcagcctcccacaaggtcaaagagttctgtgaaaatctctcagctgactgccgggagaat
gtgatcatgactcagatcttgccctgcatcaaggagcttgtgtcagatgccaaccaacat
gtcaagtcagcactggcttcagtcatcatgggcctctctcccattctgggcaaagacaac
accatcgaacacctcttgcccctgttcttggctcagctgaaggatgagtgtcctgaagtc
cgactgaatatcatctccaacctggattgtgtgaacgaggtgattggcatcaggcagctc
tctcagtccctgcttcctgccatcgtggaactagctgaagatgccaagtggcgagtgcgg
ctggccatcattgaatacatgcctctgctggctggacagcttggtgtggaattttttgat
gagaaactaaactctttgtgtatggcctggctagtggatcatgtctatgctatccgtgag
gctgccaccagcaaccttaagaaattagtagagaagttcgggaaggagtgggcccatgcc
actatcatccccaaggtcttagccatgtctggagaccctaactacctgcaccgaatgact
acactcttctgcatcaatgtgttgtctgaggtctgtggacaggatatcaccaccaagcac
atgctgcccacagttcttcgtatggcaggggacccagttgccaatgtccgcttcaatgtg
gccaagtcactccagaagataggacccattcttgataacagcaccctgcagagtgaagtc
aagcccatcctggagaagctgacccaggaccaggatgtggatgtcaagtactttgcccag
gaggctctgactgttctctctcttgcctga

KEGG   Mus musculus (mouse): 52432
Entry
52432             CDS       T01002                                 

Gene name
Ppp2r2d, 1300017E19Rik, D7Ertd753, D7Ertd753e, MDS02, MDS026
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, delta
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu04728  Dopaminergic synapse
mmu05142  Chagas disease
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    52432 (Ppp2r2d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    52432 (Ppp2r2d)
   04071 Sphingolipid signaling pathway
    52432 (Ppp2r2d)
   04151 PI3K-Akt signaling pathway
    52432 (Ppp2r2d)
   04152 AMPK signaling pathway
    52432 (Ppp2r2d)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    52432 (Ppp2r2d)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    52432 (Ppp2r2d)
  09156 Nervous system
   04728 Dopaminergic synapse
    52432 (Ppp2r2d)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    52432 (Ppp2r2d)
   05165 Human papillomavirus infection
    52432 (Ppp2r2d)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    52432 (Ppp2r2d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    52432 (Ppp2r2d)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    52432 (Ppp2r2d)
   03036 Chromosome and associated proteins [BR:mmu03036]
    52432 (Ppp2r2d)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     52432 (Ppp2r2d)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     52432 (Ppp2r2d)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     52432 (Ppp2r2d)
SSDB
Motif
Pfam: Y_phosphatase2
Other DBs
NCBI-GeneID: 52432
NCBI-ProteinID: NP_080667
MGI: 1289252
Ensembl: ENSMUSG00000041769
Vega: OTTMUSG00000029360
UniProt: Q925E7
Position
7 F4; 7 82.95 cM
AA seq 453 aa
MAGAGGGGCPAGGNDFQWCFSQVKGAVDEDVAEADIISTVEFNYSGDLLATGDKGGRVVI
FQREQENKGRAHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAHFLLST
NDKTIKLWKISERDKRAEGYNLKDEDGRLRDPFRITALRVPILKPMDLMVEASPRRIFAN
AHTYHINSISVNSDHETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEF
HPHQCNVFVYSSSKGTIRLCDMRSSALCDRHAKFFEEPEDPSSRSFFSEIISSISDVKFS
HSGRYMMTRDYLSVKVWDLNMEGRPVETHQVHEYLRSKLCSLYENDCIFDKFECCWNGSD
SAIMTGSYNNFFRMFDRNTRRDVTLEASRENSKPRASLKPRKVCTGGKRKKDEISVDSLD
FNKKILHTAWHPMESIIAVAATNNLYIFQDKIN
NT seq 1362 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggcggcggctgcccggcgggcggcaacgacttccagtggtgcttc
tcgcaggtgaagggcgctgtcgacgaggacgtggcggaagccgacatcatctccaccgtt
gagtttaactactctggagaccttcttgcaacaggagacaaaggtggcagagttgttatt
ttccagcgggaacaagagaataaaggccgcgctcactctaggggagagtacaatgtttac
agtacctttcagagtcatgagccagagtttgactatttgaaaagtctagaaattgaagaa
aaaattaataaaatcaggtggttaccgcaacagaatgctgctcattttctactctctaca
aatgataaaactattaaattatggaaaataagtgaacgggataaaagagcagaaggttat
aacttgaaagatgaagatggacgacttcgagacccatttagaattacggcactacgggtt
ccaatattgaagcccatggaccttatggtagaagcaagtccacgacgaatttttgcaaat
gctcatacatatcacataaattccatttcagtaaatagtgatcatgaaacatatctctct
gcagatgatctgagaattaacctatggcatttagaaatcacagatagaagcttcaacatt
gtggacatcaagccagctaatatggaggagctgacagaagtcatcactgccgcagagttc
cacccacatcagtgcaatgtatttgtttacagcagcagcaagggcaccatcaggctgtgt
gacatgcgttcctctgccctatgtgacaggcatgccaagttttttgaagagccagaagat
cccagcagtagatccttcttctcagaaataatctcatctatatctgatgtcaagttcagc
cacagtggtcgatacatgatgaccagagactatctgtcggtgaaggtctgggacctcaac
atggagggcaggcctgtggagacccaccaggtacatgagtacctgcgaagcaagctctgc
tccttgtatgagaacgactgcatctttgacaagttcgagtgctgctggaacggttcagac
agtgccattatgacggggtcctacaacaacttctttagaatgtttgatagaaacactcgg
agggatgttacactggaagcctcaagagagaacagcaaaccccgagccagcctgaagccc
cggaaagtatgtacagggggtaagagaaagaaagacgagattagcgtggacagtttggac
ttcaataagaagatcctccacacagcctggcaccccatggagagcattattgctgtagct
gccaccaataacttgtatatattccaggacaaaattaattaa

KEGG   Mus musculus (mouse): 71978
Entry
71978             CDS       T01002                                 

Gene name
Ppp2r2a, 2410004D02Rik, mKIAA1541
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, alpha
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu04728  Dopaminergic synapse
mmu05142  Chagas disease
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    71978 (Ppp2r2a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    71978 (Ppp2r2a)
   04071 Sphingolipid signaling pathway
    71978 (Ppp2r2a)
   04151 PI3K-Akt signaling pathway
    71978 (Ppp2r2a)
   04152 AMPK signaling pathway
    71978 (Ppp2r2a)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    71978 (Ppp2r2a)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    71978 (Ppp2r2a)
  09156 Nervous system
   04728 Dopaminergic synapse
    71978 (Ppp2r2a)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    71978 (Ppp2r2a)
   05165 Human papillomavirus infection
    71978 (Ppp2r2a)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    71978 (Ppp2r2a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    71978 (Ppp2r2a)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    71978 (Ppp2r2a)
   03036 Chromosome and associated proteins [BR:mmu03036]
    71978 (Ppp2r2a)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     71978 (Ppp2r2a)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     71978 (Ppp2r2a)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     71978 (Ppp2r2a)
SSDB
Motif
Pfam: ANAPC4_WD40
Other DBs
NCBI-GeneID: 71978
NCBI-ProteinID: NP_082308
MGI: 1919228
Ensembl: ENSMUSG00000022052
UniProt: Q6P1F6 Q3TT94
Position
14; 14 D1
AA seq 447 aa
MAGAGGGNDIQWCFSQVKGAVDDDVAEADIISTVEFNHSGELLATGDKGGRVVIFQQEQE
NKIQSHSRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQKNAAQFLLSTNDKTIK
LWKISERDKRPEGYNLKEEDGRYRDPTTVTTLRVPVFRPMDLMVEASPRRIFANAHTYHI
NSISINSDYETYLSADDLRINLWHLEITDRSFNIVDIKPANMEELTEVITAAEFHPNSCN
TFVYSSSKGTIRLCDMRASALCDRHSKLFEEPEDPSNRSFFSEIISSISDVKFSHSGRYM
MTRDYLSVKIWDLNMENRPVETYQVHEYLRSKLCSLYENDCIFDKFECCWNGSDSVVMTG
SYNNFFRMFDRNTKRDITLEASRENNKPRTVLKPRKVCASGKRKKDEISVDSLDFNKKIL
HTAWHPKENIIAVATTNNLYIFQDKVN
NT seq 1344 nt   +upstreamnt  +downstreamnt
atggcaggagctggaggagggaatgatattcagtggtgtttttctcaggtgaaaggagca
gtagatgatgacgtagcagaagcagatataatttctacagtagagtttaatcattctgga
gaattactagccacaggagataaaggtgggagagttgtcatctttcaacaagagcaggag
aacaaaatccagtctcatagcagaggagaatacaatgtttacagcaccttccagagccat
gagccagaatttgactacttgaaaagcttagaaatagaagagaagatcaacaaaattagg
tggttaccccagaaaaatgctgcccagtttttattgtctaccaacgataaaacaataaaa
ttatggaaaatcagtgaaagagacaaaagaccagaaggctataacttgaaagaggaagat
ggaagatatagagatcctactacagtcactacgctacgggtgcccgtatttaggcccatg
gatctaatggtggaagccagtccacggagaatatttgccaacgcccacacttatcacatc
aactcaatttctatcaatagtgattatgaaacctacttatcagcagatgatttgcgaatt
aatctctggcatctggaaattacagacaggagttttaatattgtggatatcaagcctgcc
aatatggaagagctcacggaggtgatcacggctgcagaatttcaccccaacagctgtaac
acgtttgtgtacagcagcagtaaaggaactattcggttatgtgacatgagggcatctgcg
ctctgtgacaggcattctaaactgtttgaagaacctgaagatcccagcaacaggtcattt
ttttctgaaatcatctcctctatttctgatgtaaaattcagccatagcggtcgttatatg
atgactagagactatttgtcagtcaaaatttgggacttgaatatggagaacaggcccgtg
gagacataccaggtacatgaatacctcagaagtaaactttgctcactgtatgaaaacgac
tgcatatttgacaaatttgaatgttgttggaatgggtctgacagtgttgtcatgactgga
tcctacaataatttcttcagaatgttcgacaggaacacaaagcgggatataaccctagaa
gcatcacgagagaacaataagcctcgcacggttttgaagccacgcaaagtctgtgcaagt
ggcaagcgaaagaaagatgaaataagtgttgacagcctagacttcaacaagaaaatcctt
catacagcctggcatcccaaggaaaacatcattgctgtagcaactacaaacaatctgtat
atatttcaagacaaagtgaattag

KEGG   Mus musculus (mouse): 72930
Entry
72930             CDS       T01002                                 

Gene name
Ppp2r2b, 2900026H06Rik, 6330404L05Rik, E130009M08Rik, PP2A-, PP2A-PR55B, PR55-B, PR55-BETA, SCA, SCA12
Definition
(RefSeq) protein phosphatase 2, regulatory subunit B, beta
  KO
K04354  serine/threonine-protein phosphatase 2A regulatory subunit B
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu04728  Dopaminergic synapse
mmu05142  Chagas disease
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    72930 (Ppp2r2b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    72930 (Ppp2r2b)
   04071 Sphingolipid signaling pathway
    72930 (Ppp2r2b)
   04151 PI3K-Akt signaling pathway
    72930 (Ppp2r2b)
   04152 AMPK signaling pathway
    72930 (Ppp2r2b)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    72930 (Ppp2r2b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    72930 (Ppp2r2b)
  09156 Nervous system
   04728 Dopaminergic synapse
    72930 (Ppp2r2b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    72930 (Ppp2r2b)
   05165 Human papillomavirus infection
    72930 (Ppp2r2b)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    72930 (Ppp2r2b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    72930 (Ppp2r2b)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    72930 (Ppp2r2b)
   03036 Chromosome and associated proteins [BR:mmu03036]
    72930 (Ppp2r2b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     72930 (Ppp2r2b)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     72930 (Ppp2r2b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     72930 (Ppp2r2b)
SSDB
Other DBs
NCBI-GeneID: 72930
NCBI-ProteinID: NP_082668
MGI: 1920180
Ensembl: ENSMUSG00000024500
Vega: OTTMUSG00000028098
UniProt: Q6ZWR4
Position
18; 18 B3
AA seq 446 aa
MKCFSRYLPYIFRPPNTILSSSCHTEADIISTVEFNHTGELLATGDKGGRVVIFQREQES
KNQVHRRGEYNVYSTFQSHEPEFDYLKSLEIEEKINKIRWLPQQNAAYFLLSTNDKTVKL
WKVSERDKRPEGYNLKDEEGRLRDPATITTLRVPVLRPMDLMVEATPRRVFANAHTYHIN
SISVNSDYETYMSADDLRINLWNFEITNQSFNIVDIKPANMEELTEVITAAEFHPHHCNT
FVYSSSKGTIRLCDMRASALCDRHTKFFEEPEDPSNRSFFSEIISSISDVKFSHSGRYIM
TRDYLTVKVWDLNMENRPIETYQVHDYLRSKLCSLYENDCIFDKFECVWNGSDSVIMTGS
YNNFFRMFDRNTKRDVTLEASRENSKPRAILKPRKVCVGGKRRKDEISVDSLDFSKKILH
TAWHPSENIIAVAATNNLYIFQDKVN
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgaaatgcttctctcgttacctgccttatatcttcagacctccaaacaccatcctctct
tccagctgccatactgaagctgacattatctctacggtagaattcaaccacacgggagag
ttactagcgacgggggacaaggggggtcgggtcgtaatatttcagcgagaacaggagagt
aaaaaccaggttcatcgtaggggtgaatacaatgtttacagcacattccagagccatgaa
cccgagttcgattacctgaaaagtttagaaatagaagaaaaaatcaataagataagatgg
ctccctcaacaaaacgcagcttactttcttctgtctaccaacgataaaactgtgaagctg
tggaaagtcagtgagcgggataagaggccagaaggctacaacctgaaagatgaggagggc
cggctccgggatcctgccaccatcacaaccctgcgggtgcctgtcctgagacccatggac
ctgatggtggaggccaccccacgaagagtgtttgccaatgcgcacacgtaccacatcaac
tctatatctgtcaacagcgactatgagacctacatgtctgctgatgacctgaggattaat
ctgtggaactttgagataaccaatcagagttttaatatcgtggacatcaagccagccaac
atggaggagctcacagaggtgatcactgcagctgagttccacccccaccactgcaacacc
ttcgtatacagcagcagcaaggggacaatccggctgtgtgacatgcgtgcatctgcgctg
tgtgacaggcacaccaagttttttgaagaaccggaagatccaagcaacagatcgtttttc
tctgaaatcatctcttcaatttcggatgtgaaattcagccacagtgggaggtatatcatg
accagagactatctgaccgtgaaagtctgggacctcaacatggaaaatcgccccattgag
acataccaggttcatgactacctccgcagcaagttgtgctccctctatgaaaacgactgc
atttttgataaatttgagtgtgtatggaatgggtcagacagcgtcatcatgacaggctcc
tacaataacttcttcaggatgttcgaccgaaacaccaagcgtgatgtgacccttgaggcc
tcaagggaaaacagcaaaccccgggctatcctcaaaccccgaaaagtgtgcgtcgggggc
aagcgaagaaaagatgagatcagtgttgacagtctggactttagcaaaaagatcttgcat
acagcttggcatccttcagaaaacattatagcagtggcggctacgaataacttatatata
ttccaagacaaggttaactag

KEGG   Mus musculus (mouse): 73699
Entry
73699             CDS       T01002                                 

Gene name
Ppp2r1b, 2410091N08Rik, AI790395
Definition
(RefSeq) protein phosphatase 2, regulatory subunit A, beta
  KO
K03456  serine/threonine-protein phosphatase 2A regulatory subunit A
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04350  TGF-beta signaling pathway
mmu04390  Hippo signaling pathway
mmu04530  Tight junction
mmu04728  Dopaminergic synapse
mmu04730  Long-term depression
mmu05142  Chagas disease
mmu05160  Hepatitis C
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    73699 (Ppp2r1b)
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    73699 (Ppp2r1b)
   04390 Hippo signaling pathway
    73699 (Ppp2r1b)
   04071 Sphingolipid signaling pathway
    73699 (Ppp2r1b)
   04151 PI3K-Akt signaling pathway
    73699 (Ppp2r1b)
   04152 AMPK signaling pathway
    73699 (Ppp2r1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    73699 (Ppp2r1b)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    73699 (Ppp2r1b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    73699 (Ppp2r1b)
  09156 Nervous system
   04728 Dopaminergic synapse
    73699 (Ppp2r1b)
   04730 Long-term depression
    73699 (Ppp2r1b)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    73699 (Ppp2r1b)
   05165 Human papillomavirus infection
    73699 (Ppp2r1b)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    73699 (Ppp2r1b)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    73699 (Ppp2r1b)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    73699 (Ppp2r1b)
   03036 Chromosome and associated proteins [BR:mmu03036]
    73699 (Ppp2r1b)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     73699 (Ppp2r1b)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     73699 (Ppp2r1b)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     73699 (Ppp2r1b)
SSDB
Motif
Pfam: HEAT HEAT_2 Vac14_Fab1_bd HEAT_EZ Adaptin_N Cnd1 CLASP_N M11L AEP1
Other DBs
NCBI-GeneID: 73699
NCBI-ProteinID: NP_082890
MGI: 1920949
Ensembl: ENSMUSG00000032058
Vega: OTTMUSG00000037681
UniProt: Q7TNP2 Q8BIX1
Position
9; 9 A5.3
AA seq 601 aa
MAGAAGPGSGPGAAGGDGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTR
TELLPFLTDTIYDEDEVLLALAEQLGNFTGLVGGPDFAHCLLPPLESLATVEETVVRDKA
VESLRQISQEHTPVALEAHFVPLVKRLASGDWFTSRTSACGLFSVCYPRASNAVKAEIRQ
HFRSLCSDDTPMVRRAAASKLGEFAKVLELDSVKTEIVPLFTNLASDEQDSVRLLAVEAC
VSIAQLLSQEDLEALVMPTLRQAAEDKSWRVRYMVADKFSELQKAVGPKIALSDLIPAFQ
SLLRDCEAEVRAAAAHKVRELCENLPAEGRETVIMNQILPYIKELVSDTNQHVKSALASV
IMGLSTVLGKENTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAI
VELAEDAKWRVRLAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATNNLMK
LVQKFGTEWAQNTIVPKVLVMANDPNYLHRMTTLFCINALSEACGKEITTKQMLPIVLKM
AGDQVANVRFNVAKSLQKIGPILDTNALQGEVKPVLQKLGQDEDMDVKYFAQEAISVLAL
A
NT seq 1806 nt   +upstreamnt  +downstreamnt
atggcgggcgcagcagggccagggtccggtccgggggcagcgggtggagatggagacgat
tcgctctacccgatcgcggttttaatcgacgagctccgcaatgaggacgtgcagctccgt
ctcaacagtattaagaagttatcaactatagctctagcactcggggtagaaaggactcga
acggaactgctgcctttccttacagatactatttatgatgaagatgaggtgctgttagct
ctcgccgagcagctgggaaatttcactggtttggtgggcggtcctgactttgcccactgt
ctgctgcctcctttggaaagtttggctacggtggaggagactgtcgttcgagacaaggct
gtggagtcgctgaggcagatctcgcaggagcacactcctgttgcccttgaagctcatttt
gtgcctctggtgaagcgcctggcaagcggggactggttcacgtcgcgcacgtctgcatgt
ggcttgttcagcgtttgctatcccagagcttcaaatgctgtcaaggcagagattcgacag
cacttccgttctctctgctcggatgatacaccaatggtgcgacgtgctgctgcttccaaa
ttgggtgaatttgcaaaagttttggaattagacagtgtgaaaactgaaattgtcccattg
ttcacgaatttggcttcagatgaacaggactctgtgcggctgctagctgtggaagcctgc
gtcagcattgcccagttactgtctcaggaggacctggaagccttggtaatgcctacactt
cgacaagcagcagaagataagtcctggcgggttcgatatatggtggctgacaagttttca
gagctccagaaagcggtgggccctaagattgcactcagcgacctcatccccgccttccag
agcctcctccgagactgcgaagctgaagtccgagcagccgctgcccacaaagtaagagag
ctttgtgagaacctgcccgctgaaggtagagagactgtaattatgaatcaaatcctgccc
tatataaaggaattagtgtctgataccaaccaacatgtcaagtcagcgctagcttctgta
attatgggattatctacagttttgggcaaagagaataccattgaacatcttctgcctcta
tttttagctcagttaaaggacgagtgtccagaagttcgtttaaatatcatctccaatttg
gattgtgtgaatgaagtgattggaatccgtcagctctctcagtctctccttccggccata
gtggaactggctgaagatgccaagtggagggtccgcctggctatcattgagtacatgccg
ctgctggctggccagctgggtgtggagttctttgatgaaaaactcaattctttgtgtatg
gcctggcttgtggatcatgtctatgccattcgggaggcagccaccaacaacctcatgaag
ttagtccagaagttcggtacagagtgggcccagaataccattgtccctaaagtgttggta
atggcaaatgaccctaactacttacacagaatgaccacgctcttctgcattaatgcactg
tctgaagcctgtggtaaggaaataaccactaagcaaatgttgcccatcgtgttgaaaatg
gcaggagaccaggtagcaaatgtccgcttcaatgtggccaaatcactgcagaaaattgga
ccgattctagacaccaacgccttgcagggggaagtgaagccggtgctgcagaaattgggt
caggacgaagacatggatgtcaaatattttgcacaggaagctataagtgttcttgccttg
gcataa

DBGET integrated database retrieval system