KEGG   Mus musculus (mouse): 19054
Entry
19054             CDS       T01002                                 

Gene name
Ppp2r3d, PP2A_B''-PR59, PP2A_PR59, PR, PR59, Pp, Ppp2r3, Ppp2r3a
Definition
(RefSeq) protein phosphatase 2 (formerly 2A), regulatory subunit B'', delta
  KO
K11583  serine/threonine-protein phosphatase 2A regulatory subunit B''
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03015  mRNA surveillance pathway
mmu04071  Sphingolipid signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04152  AMPK signaling pathway
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04728  Dopaminergic synapse
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09122 Translation
   03015 mRNA surveillance pathway
    19054 (Ppp2r3d)
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    19054 (Ppp2r3d)
   04151 PI3K-Akt signaling pathway
    19054 (Ppp2r3d)
   04152 AMPK signaling pathway
    19054 (Ppp2r3d)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    19054 (Ppp2r3d)
  09156 Nervous system
   04728 Dopaminergic synapse
    19054 (Ppp2r3d)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    19054 (Ppp2r3d)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19054 (Ppp2r3d)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    19054 (Ppp2r3d)
   03036 Chromosome and associated proteins [BR:mmu03036]
    19054 (Ppp2r3d)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-2 (PP2A)
    Regulatory subunits
     19054 (Ppp2r3d)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Surveillance factors
    Protein phosphatase 2A
     19054 (Ppp2r3d)
Chromosome and associated proteins [BR:mmu03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   Other centromeric chromatin formation proteins
    PP2A (protein phosphatase 2A)
     19054 (Ppp2r3d)
SSDB
Motif
Pfam: EF-hand_13 EF-hand_7 EF-hand_5 EF-hand_8 EF-hand_1 EF-hand_6
Other DBs
NCBI-GeneID: 19054
NCBI-ProteinID: NP_001156887
MGI: 1335093
Vega: OTTMUSG00000046326
UniProt: Q8K1A4 Q4VA48 Q3UPT6
Position
9; 9 F4
AA seq 525 aa
MAPLTPRLQLKVDELFRRWLGDPHTQRALSHALRRIRDPGTTSDPAAAATPDADPGNTTS
DPNPASRPLPRPALRTTGPRTVHAHRKEEPPPQSPPPGHSVPAFYFPCGRPPPRPQDTED
AIALVECAFEGLPRGRAGLGDMAVVAKACGCPLYWKAPLFYAAGGERTGSVSVHMFVAMW
RKVLLTCHDDAARFVRLLGHPGCSGLIQEDFVPFLQDVVNSHPGLAFLRAAKDFHSRYIT
TVIQRIFYTVNRSWSGMISREELRRSSFLQAVSQLEVEPDINRMTSFFSYEHFYVIYCKF
WELDLDRDLTIDRSDLARHGDGAISSRMIDRIFSGAVTRARLPRKVGKLSYADFVWFLLS
EEDKTTPTSTEYWFRCMDLDGDGALSMFELEFFYEEQAQRMAARGVEPLPFHDLARQVLD
LVAPRCPGRITLRDLKQCGLAGEFFDAFFNVDKYLAREQREQAGTPQDTDSDPAASAWDR
YAAEEYDFLVAEEAMAEDDDDHDEGSDPIDLYGLADEDCDDLEPL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atggcgccgctgacgccgcggctacagctgaaggtggacgagctcttccggcgctggctc
ggcgatcctcacacgcagcgcgcgctcagccacgccctccgccgcatccgggacccaggg
acgacctctgaccccgccgccgccgcgacccccgatgcggaccccggaaacacgacctcc
gaccctaaccccgcctcccgaccgctgccgcggcccgcgctgagaacgacgggacccagg
acggtccatgcccacaggaaggaggagcccccgccccagtccccaccccctggccacagc
gtccccgccttctacttcccttgcggtcgacccccgccccgtccccaggacacggaggat
gccatcgccctcgtggagtgcgcgttcgaggggctgcctcgtgggagggcgggtctgggc
gacatggccgtggttgccaaggcctgtggctgccctctgtactggaaggccccgctgttc
tacgctgcgggcggcgagcgcacaggctctgtatccgtgcacatgttcgtagctatgtgg
cgcaaagtcctgctgacctgccatgatgatgctgcgcggttcgtgcggctgctgggccac
cccgggtgtagtggcctcatccaggaggactttgtgcccttcctgcaggatgtggtgaac
tcgcacccgggcctggccttcctgagggcagcgaaggacttccactcacgttacatcacc
acagtgattcagaggatcttctacacagtaaaccggtcatggtcagggatgatctcgcgt
gaggagctaaggcgcagcagcttcctgcaggctgtgtcacagttggaggtagagcctgac
atcaaccgcatgacgtcgttcttctcttatgagcatttctatgtcatctactgcaagttc
tgggagctcgacctcgaccgcgacctcaccattgacaggagcgacctcgcacgccatggg
gacggggccatctcctccagaatgattgaccgcatcttctcaggggccgtcaccagggcg
aggctgccccgaaaggtcgggaagctgagctacgcagactttgtatggttcctgctctcc
gaggaggacaagactacgcccaccagcaccgagtactggttccgttgcatggacctggac
ggtgacggcgctctctccatgtttgagctcgagttcttctatgaggagcaggcccagcgc
atggccgcccggggtgtggagcccctccccttccacgaccttgcacgccaggtgctcgac
ctcgtcgccccgcgctgccccggccggatcacgctgcgcgacctgaagcagtgcggcctg
gcgggtgagttcttcgacgccttcttcaacgtggacaagtacctggcacgggagcagcgc
gagcaggcggggactccgcaggacactgactccgaccccgcggcatctgcctgggacagg
tatgccgccgaggagtacgacttcctcgtggccgaggaggccatggcagaggacgacgac
gaccatgacgaagggtccgaccccatagatctctacggccttgctgacgaggactgcgac
gacctggagcctctgtga

DBGET integrated database retrieval system