KEGG   Mus musculus (house mouse): 19059
Entry
19059             CDS       T01002                                 
Symbol
Ppp3r2, CaNB2, CnB2
Name
(RefSeq) protein phosphatase 3, regulatory subunit B, alpha isoform (calcineurin B, type II)
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04020  Calcium signaling pathway
mmu04022  cGMP-PKG signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04310  Wnt signaling pathway
mmu04360  Axon guidance
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04625  C-type lectin receptor signaling pathway
mmu04650  Natural killer cell mediated cytotoxicity
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04662  B cell receptor signaling pathway
mmu04720  Long-term potentiation
mmu04724  Glutamatergic synapse
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04924  Renin secretion
mmu05010  Alzheimer disease
mmu05014  Amyotrophic lateral sclerosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05031  Amphetamine addiction
mmu05152  Tuberculosis
mmu05163  Human cytomegalovirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19059 (Ppp3r2)
   04310 Wnt signaling pathway
    19059 (Ppp3r2)
   04370 VEGF signaling pathway
    19059 (Ppp3r2)
   04020 Calcium signaling pathway
    19059 (Ppp3r2)
   04022 cGMP-PKG signaling pathway
    19059 (Ppp3r2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    19059 (Ppp3r2)
   04218 Cellular senescence
    19059 (Ppp3r2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    19059 (Ppp3r2)
   04650 Natural killer cell mediated cytotoxicity
    19059 (Ppp3r2)
   04660 T cell receptor signaling pathway
    19059 (Ppp3r2)
   04658 Th1 and Th2 cell differentiation
    19059 (Ppp3r2)
   04659 Th17 cell differentiation
    19059 (Ppp3r2)
   04662 B cell receptor signaling pathway
    19059 (Ppp3r2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    19059 (Ppp3r2)
   04921 Oxytocin signaling pathway
    19059 (Ppp3r2)
   04924 Renin secretion
    19059 (Ppp3r2)
  09156 Nervous system
   04724 Glutamatergic synapse
    19059 (Ppp3r2)
   04720 Long-term potentiation
    19059 (Ppp3r2)
  09158 Development and regeneration
   04360 Axon guidance
    19059 (Ppp3r2)
   04380 Osteoclast differentiation
    19059 (Ppp3r2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    19059 (Ppp3r2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    19059 (Ppp3r2)
   05170 Human immunodeficiency virus 1 infection
    19059 (Ppp3r2)
   05163 Human cytomegalovirus infection
    19059 (Ppp3r2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19059 (Ppp3r2)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    19059 (Ppp3r2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19059 (Ppp3r2)
   05014 Amyotrophic lateral sclerosis
    19059 (Ppp3r2)
   05020 Prion disease
    19059 (Ppp3r2)
   05022 Pathways of neurodegeneration - multiple diseases
    19059 (Ppp3r2)
  09165 Substance dependence
   05031 Amphetamine addiction
    19059 (Ppp3r2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    19059 (Ppp3r2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19059 (Ppp3r2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     19059 (Ppp3r2)
SSDB
Motif
Pfam: EF-hand_1 EF-hand_5 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_4 SPARC_Ca_bdg EF-hand_9
Other DBs
NCBI-GeneID: 19059
NCBI-ProteinID: NP_001004025
MGI: 107171
Ensembl: ENSMUSG00000028310
UniProt: Q63811 Q497S1
Position
4:complement(49678747..49681983)
AA seq 179 aa
MGNEASYQTELCNHFDQEEIRRLGKSFRKLDLDKSGSLSIEEFMRLPELQQNPLVGRVID
IFDTDGNGEVDFHEFIVGTSQFSVKGDEEQKLRFAFRIYDMDNDGFISNGELFQVLKMMV
GNNLKDWQLQQLVDKSILVLDKDGDGRISFEEFSDVVKTMEIHKKLVVFVEHGQEDLKA
NT seq 540 nt   +upstreamnt  +downstreamnt
atgggaaatgaggccagctaccaaactgagctgtgcaaccacttcgaccaggaagagata
agaaggctgggtaaaagcttcaggaagctggacttggacaaatcgggctccctgagcata
gaagagttcatgaggctgcctgagctgcagcagaatccgctggtgggccgagtgatcgac
atcttcgacacagacggcaacggggaagtggacttccacgagttcatcgtgggcacctcc
cagttcagcgtcaagggtgatgaagagcagaagctaaggttcgccttcagaatctacgac
atggataatgatggcttcatctccaatggggagctcttccaggtgcttaagatgatggtg
ggaaacaacctcaaggactggcagctgcagcagctggtggacaagagcatcttggtcctg
gataaggatggcgatggccggatatcctttgaagagttcagtgatgtggtcaagaccatg
gagatccacaagaaattggtcgtgtttgtagaacacggtcaagaagacttaaaagcttaa

DBGET integrated database retrieval system