KEGG   Mus musculus (mouse): 19060
Entry
19060             CDS       T01002                                 

Symbol
Ppp5c, AU020526, PP5
Name
(RefSeq) protein phosphatase 5, catalytic subunit
  KO
K04460  serine/threonine-protein phosphatase 5 [EC:3.1.3.16]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19060 (Ppp5c)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19060 (Ppp5c)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19060 (Ppp5c)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    Catalytic subunits
     19060 (Ppp5c)
SSDB
Motif
Pfam: Metallophos PPP5 TPR_1 TPR_2 TPR_11 TPR_16 TPR_8 TPR_9 TPR_14 TPR_19 TPR_17 TPR_6 TPR_12 TPR_7 AAA_assoc_2 MIT
Other DBs
NCBI-GeneID: 19060
NCBI-ProteinID: NP_035285
MGI: 102666
Ensembl: ENSMUSG00000003099
Vega: OTTMUSG00000016479
UniProt: Q60676
Position
7:complement(16738565..16761839)
AA seq 499 aa
MAMAEGERTECAETPRDEPPADGTLKRAEELKTQANDYFKAKDYENAIKFYSQAIELNPG
NAIYYGNRSLAYLRTECYGYALGDATRAIELDKKYIKGYYRRAASNMALGKFRAALRDYE
TVVKVKPNDKDAKMKYQECSKIVKQKAFERAIAGDEHRRSVVDSLDIESMTIEDEYSGPK
LEDGKVTITFMKDLMQWYKDQKKLHRKCAYQILVQVKEVLCKLSTLVETTLKETEKITVC
GDTHGQFYDLLNIFELNGLPSETNPYIFNGDFVDRGSFSVEVILTLFGFKLLYPDHFHLL
RGNHETDNMNQIYGFEGEVKAKYTAQMYELFSEVFEWLPLAQCINGKVLIMHGGLFSEDG
VTLDDIRKIERNRQPPDSGPMCDLLWSDPQPQNGRSVSKRGVSCQFGPDVTKAFLEENQL
DYIIRSHEVKAEGYEVAHGGRCVTVFSAPNYCDQMGNKASYIHLQGSDLRPQFHQFTAVP
HPNVKPMAYANTLLQLGMM
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggcgatggcggagggcgagcggactgagtgtgctgagaccccccgggacgaacccccg
gccgatggcactctgaagcgggcagaggagctcaagacacaggccaacgactacttcaaa
gccaaggactacgagaacgcgatcaagttctacagtcaggccatcgagttgaaccccggc
aatgccatctactatggcaaccgcagcctggcctacctgcgcactgagtgctatggctat
gcactgggcgacgccacacgggccatcgagcttgacaagaagtacatcaaaggctactac
cgccgggcggccagcaacatggcactgggcaagttccgggctgccctgcgtgactacgag
acggtggtgaaagtgaagcctaatgacaaggatgccaagatgaagtaccaggagtgcagc
aagattgtgaagcagaaggcctttgagagggccattgcgggtgacgagcacagacgctct
gtcgtggactctctggacattgaaagcatgaccattgaagatgagtacagcgggcccaag
cttgaggatggcaaagtgacaatcaccttcatgaaagacctcatgcagtggtacaaggat
cagaagaaactgcaccggaagtgcgcctaccagatcctagtacaggtgaaagaagtcctc
tgcaagctgagcacgctggtggagacgacgctgaaagagacagagaagattacagtgtgc
ggggacacccatggccagttctacgacctcctcaacatatttgagctcaacggtttaccc
tcagagaccaacccctatatatttaatggcgattttgtggaccgtggttccttctccgtt
gaagtgatcctcaccctcttcggctttaagctcctgtatccagatcatttccatctactt
cgaggcaaccacgagacagacaacatgaaccagatctacgggttcgagggcgaggtgaag
gccaagtacacagcccagatgtatgagctcttcagcgaggtgttcgagtggcttccgctg
gcgcagtgtatcaatggcaaagtgctgatcatgcacggaggcctattcagcgaagatggt
gtcactctggatgacatccgaaagattgagcggaatcggcagcccccagactcaggtccc
atgtgtgacctgctgtggtcagatccccagccacagaatgggcgctccgtcagcaagcgt
ggtgtgagttgccagtttgggcctgatgtcaccaaggccttcctggaggagaatcaactg
gactatatcatccgcagccatgaagtcaaagccgagggctacgaggtggcccatggtggc
cgctgtgtcactgtcttttctgcccccaactattgtgaccagatgggaaacaaagcctcc
tacatccacctccagggctccgacctgcggccccagttccaccaattcacagcagtgcct
caccccaatgtcaagcccatggcatacgccaacacgcttctgcagctaggaatgatgtga

DBGET integrated database retrieval system