KEGG   Mus musculus (mouse): 19063Help
Entry
19063             CDS       T01002                                 

Gene name
Ppt1, 9530043G02Rik, AA960502, C77813, CLN1, D4Ertd184e, INCL, PPT
Definition
(RefSeq) palmitoyl-protein thioesterase 1
  KO
K01074  palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00062  Fatty acid elongation
mmu01100  Metabolic pathways
mmu01212  Fatty acid metabolism
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00062 Fatty acid elongation
    19063 (Ppt1)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    19063 (Ppt1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     19063 (Ppt1)
Lipid biosynthesis proteins [BR:mmu01004]
 Fatty acid synthase
  Component type
   19063 (Ppt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Palm_thioest Glyco_hydro_98M U71
Motif
Other DBs
NCBI-GeneID: 19063
NCBI-ProteinID: NP_032943
MGI: 1298204
Ensembl: ENSMUSG00000028657
Vega: OTTMUSG00000008871
UniProt: O88531 Q3U6J9 Q3U6W3 Q3TEL0
Position
4 D2.2; 4 57.27 cM
AA seq 306 aa AA seqDB search
MASSCSRRLLAAALLPWCCAAWALGHLDPPSPPPLVIWHGMGDSCCNPMSMGVIKKMVEK
EIPGIYVLSLEIGKNMMEDVENSFFLNVNVQVNMVCQILEKDPKLQQGYNAIGFSQGGQF
LRAVAQRCPTPPMMTLISVGGQHQGVFGLPRCPGESSHICDFIRKSLNAGAYSKLVQERL
VQAQYWHDPIKESVYRNYSIFLADINQERCVNESYKKNLMALKKFVMVKFFNDSIVDPVD
SEWFGFYRSGQAKETIPLQESTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAH
IIPFLK
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcctgttcgcggaggctgctagctgccgctctgctgccttggtgctgcgcc
gcctgggccctggggcatctggacccaccttcaccaccaccgctggtgatctggcatggg
atgggggacagctgttgtaaccccatgagcatgggtgtcattaaaaagatggttgaaaaa
gaaatacctgggatttacgtcctgtctctagagattgggaagaacatgatggaggatgtg
gagaacagcttcttcttgaatgttaatgtccaagtcaacatggtgtgtcagattctggaa
aaggatcctaagttgcagcagggatacaatgctattggcttctcccagggaggccagttc
ctgagggcagtggctcagagatgcccaacacctcccatgatgaccctgatctcagttgga
ggacaacatcaaggtgtctttggactcccccgatgcccaggagagagttctcacatctgc
gacttcatcaggaagtcacttaatgccggtgcttactccaaacttgtgcaagaacgcctg
gtgcaagcacagtactggcatgaccctatcaaggagagtgtgtaccgaaactacagcatc
ttcttggcagacataaatcaagagaggtgtgtcaatgagtcctacaagaagaacctgatg
gccctcaagaagtttgtgatggtgaaattctttaatgattccattgtggaccctgtcgac
tctgagtggtttggattttacagaagtggccaagctaaggaaaccattcccctccaggag
agcactctatacacagaggaccgcctggggctaaagaaaatggacaaagcaggaaagcta
gtgtttctggctaaggaaggggaccatcttcaaatatctaaagaatggtttactgcccac
atcataccttttcttaagtga

DBGET integrated database retrieval system