KEGG   Mus musculus (mouse): 19075
Entry
19075             CDS       T01002                                 

Gene name
Prim1, AI324982
Definition
(RefSeq) DNA primase, p49 subunit
  KO
K02684  DNA primase small subunit [EC:2.7.7.102]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    19075 (Prim1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    19075 (Prim1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.102  DNA primase AEP
     19075 (Prim1)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    19075 (Prim1)
SSDB
Motif
Pfam: DNA_primase_S
Other DBs
NCBI-GeneID: 19075
NCBI-ProteinID: NP_032947
MGI: 97757
Ensembl: ENSMUSG00000025395
Vega: OTTMUSG00000033813
UniProt: P20664 Q5FW94
Position
10 76.39 cM; 10 D3
AA seq 417 aa
MEPFDPAELPELLKLYYRRLFPYAQYYRWLNYGGVTKNYFQHREFSFTLKDDIYIRYQSF
NNQSELEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRR
CCSSADICSKCWTLMTMAMRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSA
VRSGIVEYLSLVKGGQDVKKKVHLNEKVHPFVRKSINIIKKYFEEYALVGQDILENKENW
DKILALVPETIHDELQRGFQKFHSSPQRWEHLRKVANSSQNMKNDKCGPWLEWEVMLQYC
FPRLDVNVSKGVNHLLKSPFSVHPKTGRISVPIDFHKVDQFDPFTVPTISAICRELDMVS
THEKEKEENEADSKHRVRGYKKTSLAPYVKVFEQFLENLDKSRKGELLKKSDLQKDF
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggagccatttgatcctgcggagctgccggagctactcaagctttattaccgaaggctc
tttccctacgcccagtactatcgctggctcaactatggcggagtgacaaagaattacttt
caacaccgtgaattttcattcacactgaaagatgatatttacattcgctaccagtccttc
aacaaccagagtgaactggagaaggagatgcagaaaatgaatccatataagattgatata
ggcgcagtatattctcacagacccaatcaacacaatacagtgaagctgggagctttccag
gcccaggagaaagaactggtctttgacatcgacatgacagactacgatgacgtaaggaga
tgctgcagttctgcagacatatgttccaaatgctggactctcatgacaatggccatgcgc
atcatagaccgggcattgaaggaggactttggatttaagcaccgcctctgggtctattca
ggaaggagaggtgtgcactgttgggtctgtgatgaatccgttcgaaagctgtcctctgct
gtgcgctccgggatcgtggagtacttgagtcttgtaaagggtggtcaagatgttaaaaag
aaagttcacctaaatgagaaagttcacccttttgtcagaaaatctataaacataattaaa
aagtactttgaggaatatgccttagtcggccaagatattcttgaaaataaagaaaactgg
gataagattttagcccttgttcctgagacaattcatgatgagctgcaaagagggttccag
aagttccacagttcacctcagcgctgggaacacctgaggaaagtggccaactcatctcag
aatatgaagaacgataagtgcggcccctggctggagtgggaggtcatgctccagtactgt
ttcccacgcctggatgtcaacgtcagcaagggagtcaatcacttactgaagagccctttc
agtgttcatcccaagacaggtcggatttctgtgcctatcgattttcataaagtggatcaa
tttgatccgtttactgtcccaactataagtgccatctgccgggaattggatatggtttcc
actcatgagaaggaaaaggaggagaatgaagctgacagcaaacacagagtcagaggttac
aagaagaccagtctagcaccgtatgtgaaagtatttgaacagtttcttgaaaacctggat
aaatcccggaaaggggaacttctcaagaagagcgatttacaaaaagatttctga

DBGET integrated database retrieval system