KEGG   Mus musculus (mouse): 19076
Entry
19076             CDS       T01002                                 

Gene name
Prim2, AI323589
Definition
(RefSeq) DNA primase, p58 subunit
  KO
K02685  DNA primase large subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03030  DNA replication
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    19076 (Prim2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mmu03032]
    19076 (Prim2)
DNA replication proteins [BR:mmu03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    19076 (Prim2)
SSDB
Motif
Pfam: DNA_primase_lrg
Other DBs
NCBI-GeneID: 19076
NCBI-ProteinID: NP_032948
MGI: 97758
Ensembl: ENSMUSG00000026134
Vega: OTTMUSG00000049047
UniProt: P33610
Position
1 12.7 cM; 1 B
AA seq 505 aa
MQFSGRIRKKLRLAGDQRNASYPHSLQFYLQPPTENISLTEFENLAFDRVKLLKAIENLG
VSYVKGTEQYQSKLEAEIRKLKFSYRENLEDEYEPRRRDHISHFILRLAYCQSEDLRRWF
IQQEMDLLRFRFSILPKDKVQSFLKDSHLHFEAISDEEKTLREQDIMASSPSLSGIKLES
ESVYKVPFADALDLFRGRKVYLEDGFAYVPLKDIVAIILNEFRATLSKALALTARSLPAV
QSDERLQPLLNHLSHSYTGQDYSTQKNTGKISLDQIDSLSTKSFPPCMRQLHKALRENHH
LRHGGRMQYGLFLKGIGLTLEQALQFWKQEFIRGKMDPDKFDKGYSYNIRHSFGKEGKRT
DYTPFSCMKIILTNPPGQGDYHGCPFRHSDAELLKQKMQSYKIPASGISQILDLVKGNHY
QVACQKYFEMTHNVDDCGFSLNHPNQFFFESQRILTGGKDIKKEISQPETPQHKPSTQKT
RDAASALASLDSSLEMDLEGLEEYF
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgcagttctcaggaaggatccggaagaagctgcgattggcgggtgaccagagaaatgct
agttaccctcacagccttcagttttacctgcagccgcctactgaaaacatatcgttgacg
gagtttgaaaacttggcttttgacagagttaaattgcttaaagcaattgagaacctcggt
gtgagctatgtgaaaggaaccgaacaataccagagtaaattggaggccgagattcgaaag
ctcaagttttcctacagagagaacctggaggatgagtatgagccacggcgaagggaccac
atctcccactttatcctacgcctcgcgtactgccagtcggaagatcttagacgatggttt
attcaacaagaaatggatctgcttcggtttcgattcagtattttaccaaaggataaagtc
cagagtttcttgaaggatagtcatttgcattttgaggctatcagtgacgaggagaagacc
cttcgggaacaggatatcatggcgtcctctccaagcctaagtgggatcaagttggagtca
gagtcagtttataaggtcccctttgctgatgctctggacctgttcagaggaaggaaagtc
tacttggaagatggctttgcttatgtgccacttaaggacatcgtggccattatcttgaac
gagtttagagccacgctgtctaaggctttggcactaacggccaggtcgctgcctgctgtg
cagtccgatgaacgacttcagcctctgctcaaccacctcagtcattcttacactggtcaa
gattatagtacccagaagaacaccggcaagatttccttagatcagattgattcgctgtct
acaaaatccttcccaccttgcatgcgtcagctgcacaaggcgctgagggagaaccaccat
ctccgtcacggaggccggatgcagtacggcctgttcctcaagggcattgggctaacgctg
gagcaggcattgcagttctggaagcaggagtttatcagaggaaagatggacccagacaag
tttgataaaggttactcttacaatatccggcatagcttcggaaaggaaggcaagaggaca
gactatacgcctttcagttgcatgaagattatcctgaccaacccaccaggccaaggggat
tatcatgggtgccccttccgtcacagtgatgcagagctgctgaagcagaagatgcagtcc
tacaagatccctgcctcggggatcagccagattttggatttggtaaaggggaatcattac
caagtagcctgtcagaagtacttcgagatgacacataatgtggacgattgtggcttttct
ttgaatcatccaaatcagttcttttttgagagccagcgcatcctaactggtggcaaagat
atcaagaaggaaatcagtcagccagaaacacctcagcacaaacctagcacccagaagacc
agggatgctgcatctgcgctggcctccctagactcctccctggaaatggacctggagggg
ctggaagagtacttttag

DBGET integrated database retrieval system