KEGG   Mus musculus (mouse): 19082Help
Entry
19082             CDS       T01002                                 

Gene name
Prkag1, AA571379, BB036179, Prkaac
Definition
(RefSeq) protein kinase, AMP-activated, gamma 1 non-catalytic subunit
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04068  FoxO signaling pathway
mmu04152  AMPK signaling pathway
mmu04211  Longevity regulating pathway
mmu04213  Longevity regulating pathway - multiple species
mmu04371  Apelin signaling pathway
mmu04530  Tight junction
mmu04710  Circadian rhythm
mmu04714  Thermogenesis
mmu04910  Insulin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04921  Oxytocin signaling pathway
mmu04922  Glucagon signaling pathway
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease (NAFLD)
mmu05410  Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    19082 (Prkag1)
   04068 FoxO signaling pathway
    19082 (Prkag1)
   04152 AMPK signaling pathway
    19082 (Prkag1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    19082 (Prkag1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    19082 (Prkag1)
   04922 Glucagon signaling pathway
    19082 (Prkag1)
   04920 Adipocytokine signaling pathway
    19082 (Prkag1)
   04921 Oxytocin signaling pathway
    19082 (Prkag1)
  09149 Aging
   04211 Longevity regulating pathway - mammal
    19082 (Prkag1)
   04213 Longevity regulating pathway - multiple species
    19082 (Prkag1)
  09159 Environmental adaptation
   04710 Circadian rhythm
    19082 (Prkag1)
   04714 Thermogenesis
    19082 (Prkag1)
 09160 Human Diseases
  09165 Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    19082 (Prkag1)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    19082 (Prkag1)
   04931 Insulin resistance
    19082 (Prkag1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBS Cbl_N3 DRTGG DUF2497
Motif
Other DBs
NCBI-GeneID: 19082
NCBI-ProteinID: NP_058061
MGI: 108411
Ensembl: ENSMUSG00000067713
UniProt: O54950 Q3TWR3
Position
15 F1; 15 54.73 cM
AA seq 330 aa AA seqDB search
MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAF
FALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVY
LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFIT
EFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIY
SKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLV
VVDEHDVVKGIVSLSDILQALVLTGGEKKP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggttgctgcagagagctcgccagctctagagaatgaacactttcaagagacc
ccggaatcaaacaatagtgtgtatacttccttcatgaagtctcatcgctgctatgaccta
attcccacaagttccaagttggtggtatttgacacttcgctacaggtaaagaaagccttt
tttgccctggtgaccaatggtgttcgtgccgcccctttgtgggacagtaagaagcagagt
tttgtgggcatgctgaccatcaccgacttcatcaacattttgcaccgatactataagtca
gccctggtgcagatctacgaactggaggagcacaagatagagacgtggagagaggtgtac
ctgcaggactcctttaagccacttgtctgcatctctccaaatgccagcttgtttgatgct
gtctcttcattaattcgaaataagatccacaggctcccagttatcgacccagagtcaggc
aacaccttgtacatccttactcacaagcggatcctcaagttcctcaagttgtttatcacc
gagttccccaagccggaattcatgtctaagtctctccaagagctgcagattggcacctat
gccaatattgccatggtccgtactaccacgcctgtctacgtggctctgggcatctttgta
cagcaccgagtctccgccttacctgtagtggatgagaaagggcgtgtggtggacatctac
tccaagtttgatgtgatcaatttggcagccgaaaagacctacaacaacctagatgtgtct
gtgacaaaagccctgcagcatcggtcccactactttgagggtgttctcaaatgctacctg
catgagactctggaaaccatcatcaataggctggtggaggcagaggttcaccgtctggtg
gtggtggatgaacacgacgtggtcaagggcatcgtttcgctgtctgacatcttacaggct
ctggtgctcacgggtggagagaagaagccctga

DBGET integrated database retrieval system