KEGG   Mus musculus (mouse): 19085
Entry
19085             CDS       T01002                                 

Gene name
Prkar1b, AI385716, RIbeta
Definition
(RefSeq) protein kinase, cAMP dependent regulatory, type I beta
  KO
K04739  cAMP-dependent protein kinase regulator
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    19085 (Prkar1b)
SSDB
Motif
Pfam: cNMP_binding RIIa DUF5586
Other DBs
NCBI-GeneID: 19085
NCBI-ProteinID: NP_001240819
MGI: 97759
Ensembl: ENSMUSG00000025855
Vega: OTTMUSG00000025121
UniProt: P12849 Q3TY04
Position
5 G2; 5 77.74 cM
AA seq 381 aa
MASPSCFHSEDEDSLKGCEMYVQKHGIQQVLKECIVHLCVAKPDRPLRFLREHFEKLEKE
ENRQILARQKSNSQCDSHDEEISPTPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPK
DYKTMTALAKAISKNVLFSHLDDNERSDIFDAMFPVTHIGGETVIQQGNEGDNFYVIDQG
EVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTL
RKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVVQGEPGDDFYIITEGTA
SVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLG
PCSEILKRNIQRYNSFISLTV
NT seq 1146 nt   +upstreamnt  +downstreamnt
atggcctccccatcatgcttccactcggaggatgaggactctctgaaaggatgcgagatg
tacgtgcagaaacatggcatccagcaggtgctcaaagaatgcattgtgcacctctgtgtc
gccaagccggaccggccactgcgattcctccgggagcactttgagaagttggagaaggag
gaaaacaggcagatcctggctcggcagaagtcaaactcccagtgtgattcccacgatgag
gagatctccccaacacctccaaaccccgtggtcaaggcgcgtcgccggcggggcggtgtg
agtgctgaagtctacactgaagaagatgctgtctcctacgtgaggaaggtcattcccaag
gactataagaccatgaccgcgctggccaaggccatttctaagaacgtgctcttttctcac
ctggacgacaacgagagaagtgacatatttgacgccatgtttcctgtcactcacatcggt
ggggaaacagtcatacagcaagggaatgaaggagataatttctatgtgattgaccaagga
gaagtagatgtatatgtgaacggggaatgggtgaccaacatcagtgaggggggaagcttc
ggggagctggctctcatctacggcacccccagagcggctaccgtgaaggccaagacggac
ctcaagctctggggtatcgaccgtgacagctacaggcgcatcctcatgggaagcacactg
aggaaacgcaagatgtatgaggagttcctcagcaaagtctccatcctagaatccctggag
aagtgggaacgcctgactgtagctgatgccctggagcctgtgcagtttgaagatggagag
aaaattgttgtgcagggggagcctggagatgacttctacatcatcacagagggcactgct
tcagtcctccagcgacgatcccccaatgaggagtacgtggaagtggggcgccttggaccc
tctgactactttggggagattgccctgctgctgaatcggccccgtgcagccactgtggtg
gcccggggtcccctcaagtgtgtgaagttagaccggcctcgttttgagcgtgtcctgggc
ccctgctctgagatcctgaagaggaacatccagcgttacaacagcttcatctccctaact
gtctga

DBGET integrated database retrieval system