KEGG   Mus musculus (mouse): 19089Help
Entry
19089             CDS       T01002                                 

Gene name
Prkcsh, 80K-H, PKCSH
Definition
(RefSeq) protein kinase C substrate 80K-H
  KO
K08288  protein kinase C substrate 80K-H
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    19089 (Prkcsh)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:mmu04091]
    19089 (Prkcsh)
Lectins [BR:mmu04091]
 P-type lectins
  19089 (Prkcsh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRKCSH-like PRKCSH_1 PRKCSH EF-hand_5 EF-hand_1 EF-hand_6 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 19089
NCBI-ProteinID: NP_001280580
MGI: 107877
Ensembl: ENSMUSG00000003402
Vega: OTTMUSG00000062326
UniProt: O08795 Q3U518
Structure
PDB: 

Position
9 A3; 9 8.04 cM
AA seq 521 aa AA seqDB search
MLLLLLLLLPLCWAVEVKRPRGVSLSNHHFYEESKPFTCLDGTATIPFDQVNDDYCDCKD
GSDEPGTAACPNGSFHCTNTGYKPLYILSSRVNDGVCDCCDGTDEYNSGTVCENTCREKG
RKEKESLQQLAEVTREGFRLKKILIEEWKTAREEKQSKLLELQAGKKSLEDQVETLRAAK
EEAERPEKEAKDQHRKLWEEQQAAAKARREQERAASAFQELDDNMDGMVSLAELQTHPEL
DTDGDGALSEEEAQALLSGDTQTDTTSFYDRVWAAIRDKYRSEVPPTDIPVPEETEPKEE
KPPVLPPTEEEEEEEEEPEEEEEEEEEEEEAPPPLQPPQPPSPTEDEKMPPYDEETQAII
DAAQEARSKFEEVERSLKEMEESIRSLEQEISFDFGPSGEFAYLYSQCYELTTNEYVYRL
CPFKLVSQKPKHGGSPTSLGTWGSWAGPDHDKFSAMKYEQGTGCWQGPNRSTTVRLLCGK
ETVVTSTTEPSRCEYLMELMTPAACPEPPPEAPSDGDHDEL
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgctgctactactactacccctctgttgggctgtagaagttaagagaccc
cggggcgtttccctcagcaaccatcacttctatgaagaatctaaacctttcacctgtttg
gacggcacagccaccatcccattcgatcaggtgaacgacgactactgcgactgtaaggac
ggttcagatgagcctggcacagctgcttgtcccaatggcagctttcactgcaccaacact
gggtacaagcccttgtacatcctctccagccgggtcaatgatggggtatgtgactgctgt
gatggcacagacgagtacaacagcggcacggtctgcgagaacacctgcagagagaagggt
cgcaaggaaaaagagtccctgcagcagctggcggaagtcacccgtgaagggttccgcctg
aagaagattctcattgaggagtggaagacagcccgggaagaaaagcagagtaagcttctt
gagcttcaggctggaaagaagtctctggaagaccaggtagaaacactgcgggcagcgaaa
gaagaagcagagaggccagagaaggaggccaaggaccagcaccggaagctgtgggaagag
cagcaagctgctgccaaggcccggcgggaacaggagcgggcagccagtgccttccaggaa
cttgacgacaacatggatgggatggtctcgctggctgagttacagactcacccggagctg
gacacagatggagatggagcgctgtctgaggaggaggcccaggcccttctcagtggagac
acacagactgacaccacctccttctatgaccgtgtctgggctgccatcagggacaagtac
cgctctgaggtcccgcccactgacatacctgttccggaggagactgagcccaaagaggaa
aagccaccagtgttgccacccacagaggaggaggaagaggaggaggaggagccagaagaa
gaggaggaggaagaggaagaggaggaggaggctccgcccccactgcagcccccacagcct
cccagccccacagaggatgagaagatgccgccctatgatgaggagacccaggccatcatc
gatgctgcacaggaggcccggagtaagtttgaggaagtcgaacggtccttgaaagagatg
gaagagtccatcaggagtttggaacaagagatctcctttgatttcggtccctctggagag
tttgcatatctctacagccaatgctacgagctcaccaccaatgagtacgtctaccggctt
tgccccttcaaactggtctcccagaaacccaaacatgggggctccccgaccagcctgggc
acatggggctcctgggctggccctgatcatgacaagttcagtgcgatgaagtacgagcag
ggcacgggctgttggcagggccccaaccgatccaccacagtgcgcctgctgtgtggcaaa
gagactgtggtgaccagcaccacggagcccagtcgctgtgagtacctcatggagctgatg
acaccagcagcctgcccagagccgccaccagaagcacccagtgatggggaccatgacgag
ctgtag

DBGET integrated database retrieval system