KEGG   Mus musculus (mouse): 19094Help
Entry
19094             CDS       T01002                                 

Gene name
Mapk11, P38b, Prkm11, Sapk2, Sapk2b, p38-2, p38beta, p38beta2
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04015  Rap1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04714  Thermogenesis
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05205  Proteoglycans in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    19094 (Mapk11)
   04010 MAPK signaling pathway
    19094 (Mapk11)
   04370 VEGF signaling pathway
    19094 (Mapk11)
   04668 TNF signaling pathway
    19094 (Mapk11)
   04068 FoxO signaling pathway
    19094 (Mapk11)
   04071 Sphingolipid signaling pathway
    19094 (Mapk11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    19094 (Mapk11)
   04218 Cellular senescence
    19094 (Mapk11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    19094 (Mapk11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    19094 (Mapk11)
   04620 Toll-like receptor signaling pathway
    19094 (Mapk11)
   04621 NOD-like receptor signaling pathway
    19094 (Mapk11)
   04622 RIG-I-like receptor signaling pathway
    19094 (Mapk11)
   04625 C-type lectin receptor signaling pathway
    19094 (Mapk11)
   04660 T cell receptor signaling pathway
    19094 (Mapk11)
   04658 Th1 and Th2 cell differentiation
    19094 (Mapk11)
   04659 Th17 cell differentiation
    19094 (Mapk11)
   04657 IL-17 signaling pathway
    19094 (Mapk11)
   04664 Fc epsilon RI signaling pathway
    19094 (Mapk11)
   04670 Leukocyte transendothelial migration
    19094 (Mapk11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    19094 (Mapk11)
   04914 Progesterone-mediated oocyte maturation
    19094 (Mapk11)
   04917 Prolactin signaling pathway
    19094 (Mapk11)
   04926 Relaxin signaling pathway
    19094 (Mapk11)
   04935 Growth hormone synthesis, secretion and action
    19094 (Mapk11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    19094 (Mapk11)
  09156 Nervous system
   04728 Dopaminergic synapse
    19094 (Mapk11)
   04723 Retrograde endocannabinoid signaling
    19094 (Mapk11)
   04722 Neurotrophin signaling pathway
    19094 (Mapk11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    19094 (Mapk11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    19094 (Mapk11)
  09159 Environmental adaptation
   04714 Thermogenesis
    19094 (Mapk11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    19094 (Mapk11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    19094 (Mapk11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    19094 (Mapk11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    19094 (Mapk11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    19094 (Mapk11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    19094 (Mapk11)
   05135 Yersinia infection
    19094 (Mapk11)
   05133 Pertussis
    19094 (Mapk11)
   05152 Tuberculosis
    19094 (Mapk11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    19094 (Mapk11)
   05161 Hepatitis B
    19094 (Mapk11)
   05163 Human cytomegalovirus infection
    19094 (Mapk11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19094 (Mapk11)
   05169 Epstein-Barr virus infection
    19094 (Mapk11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    19094 (Mapk11)
   05140 Leishmaniasis
    19094 (Mapk11)
   05142 Chagas disease (American trypanosomiasis)
    19094 (Mapk11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    19094 (Mapk11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    19094 (Mapk11)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     19094 (Mapk11)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   19094 (Mapk11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Cas_CT1975 Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 19094
NCBI-ProteinID: NP_035291
MGI: 1338024
Ensembl: ENSMUSG00000053137
UniProt: Q9WUI1
Position
15; 15 E3
AA seq 364 aa AA seqDB search
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPLEPSQLPGTH
EIEQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtccgcgcgcgggattctaccggcaagagctgaacaaaacagtatgggaggtg
ccgcagcggctgcagggcctacgcccggtgggctccggcgcctacggctcagtctgctcg
gcctacgacgcgcggctgcgccagaaggtggctgtaaagaagctgtctcgccctttccaa
tcgctgatccacgcgaggaggacataccgtgagctgcgcctactcaagcacctgaagcac
gagaacgtcataggacttttggacgtcttcacgccggccacatccatcgaggatttcagc
gaagtgtacctcgtgacgaccctgatgggcgccgacctgaataacatcgtcaagtgtcag
gccctgagcgatgagcatgttcaattccttgtctaccagctgctgcgtgggctgaagtat
atccactcggcgggcatcatccaccgggacctgaagcccagcaatgtagcggtgaacgag
gactgcgagctgaggatcctggactttgggctagcacgccaggctgatgaggagatgacc
ggatatgtggccacacggtggtaccgggcgccagagatcatgctaaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggctgaactgctgcaaggaaag
gccctctttcctggaaacgactacatcgaccagctgaagcgaatcatggaggtggtgggc
acgcccagtcctgaggttctggcaaagatatcctcggagcatgcccggacatacatccag
tctctgcctcccatgccccagaaggacctcagcagtgtcttccatggagccaaccccctg
gccatagacctccttggaagaatgctggtactagacagcgaccagagggtcagtgcggcc
gaagccttggcccacgcatacttcagccagtaccatgaccctgacgatgagccagaggca
gagccctatgatgaaagtgttgaggccaaggagcgcacgctggaggagtggaaggagctt
acttaccaagaagtccttagcttcaagcccctggaaccctcacagctccctggcacccat
gaaattgagcagtga

DBGET integrated database retrieval system