KEGG   Mus musculus (mouse): 19094
Entry
19094             CDS       T01002                                 

Gene name
Mapk11, P38, P38b, Prkm, Prkm11, Sa, Sapk2, Sapk2b, p38-2, p38be, p38beta, p38beta2
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04015  Rap1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04714  Thermogenesis
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu05014  Amyotrophic lateral sclerosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05205  Proteoglycans in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    19094 (Mapk11)
   04015 Rap1 signaling pathway
    19094 (Mapk11)
   04370 VEGF signaling pathway
    19094 (Mapk11)
   04668 TNF signaling pathway
    19094 (Mapk11)
   04068 FoxO signaling pathway
    19094 (Mapk11)
   04071 Sphingolipid signaling pathway
    19094 (Mapk11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    19094 (Mapk11)
   04218 Cellular senescence
    19094 (Mapk11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    19094 (Mapk11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    19094 (Mapk11)
   04613 Neutrophil extracellular trap formation
    19094 (Mapk11)
   04620 Toll-like receptor signaling pathway
    19094 (Mapk11)
   04621 NOD-like receptor signaling pathway
    19094 (Mapk11)
   04622 RIG-I-like receptor signaling pathway
    19094 (Mapk11)
   04625 C-type lectin receptor signaling pathway
    19094 (Mapk11)
   04660 T cell receptor signaling pathway
    19094 (Mapk11)
   04658 Th1 and Th2 cell differentiation
    19094 (Mapk11)
   04659 Th17 cell differentiation
    19094 (Mapk11)
   04657 IL-17 signaling pathway
    19094 (Mapk11)
   04664 Fc epsilon RI signaling pathway
    19094 (Mapk11)
   04670 Leukocyte transendothelial migration
    19094 (Mapk11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    19094 (Mapk11)
   04914 Progesterone-mediated oocyte maturation
    19094 (Mapk11)
   04917 Prolactin signaling pathway
    19094 (Mapk11)
   04926 Relaxin signaling pathway
    19094 (Mapk11)
   04935 Growth hormone synthesis, secretion and action
    19094 (Mapk11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    19094 (Mapk11)
  09156 Nervous system
   04728 Dopaminergic synapse
    19094 (Mapk11)
   04723 Retrograde endocannabinoid signaling
    19094 (Mapk11)
   04722 Neurotrophin signaling pathway
    19094 (Mapk11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    19094 (Mapk11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    19094 (Mapk11)
  09159 Environmental adaptation
   04714 Thermogenesis
    19094 (Mapk11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    19094 (Mapk11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    19094 (Mapk11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    19094 (Mapk11)
   05161 Hepatitis B
    19094 (Mapk11)
   05171 Coronavirus disease - COVID-19
    19094 (Mapk11)
   05163 Human cytomegalovirus infection
    19094 (Mapk11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19094 (Mapk11)
   05169 Epstein-Barr virus infection
    19094 (Mapk11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    19094 (Mapk11)
   05135 Yersinia infection
    19094 (Mapk11)
   05133 Pertussis
    19094 (Mapk11)
   05152 Tuberculosis
    19094 (Mapk11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    19094 (Mapk11)
   05140 Leishmaniasis
    19094 (Mapk11)
   05142 Chagas disease
    19094 (Mapk11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    19094 (Mapk11)
   05020 Prion disease
    19094 (Mapk11)
   05022 Pathways of neurodegeneration - multiple diseases
    19094 (Mapk11)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    19094 (Mapk11)
   05418 Fluid shear stress and atherosclerosis
    19094 (Mapk11)
   05415 Diabetic cardiomyopathy
    19094 (Mapk11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    19094 (Mapk11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    19094 (Mapk11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    19094 (Mapk11)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     19094 (Mapk11)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   19094 (Mapk11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 19094
NCBI-ProteinID: NP_035291
MGI: 1338024
Ensembl: ENSMUSG00000053137
UniProt: Q9WUI1
Position
15; 15 E3
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPLEPSQLPGTH
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggtccgcgcgcgggattctaccggcaagagctgaacaaaacagtatgggaggtg
ccgcagcggctgcagggcctacgcccggtgggctccggcgcctacggctcagtctgctcg
gcctacgacgcgcggctgcgccagaaggtggctgtaaagaagctgtctcgccctttccaa
tcgctgatccacgcgaggaggacataccgtgagctgcgcctactcaagcacctgaagcac
gagaacgtcataggacttttggacgtcttcacgccggccacatccatcgaggatttcagc
gaagtgtacctcgtgacgaccctgatgggcgccgacctgaataacatcgtcaagtgtcag
gccctgagcgatgagcatgttcaattccttgtctaccagctgctgcgtgggctgaagtat
atccactcggcgggcatcatccaccgggacctgaagcccagcaatgtagcggtgaacgag
gactgcgagctgaggatcctggactttgggctagcacgccaggctgatgaggagatgacc
ggatatgtggccacacggtggtaccgggcgccagagatcatgctaaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggctgaactgctgcaaggaaag
gccctctttcctggaaacgactacatcgaccagctgaagcgaatcatggaggtggtgggc
acgcccagtcctgaggttctggcaaagatatcctcggagcatgcccggacatacatccag
tctctgcctcccatgccccagaaggacctcagcagtgtcttccatggagccaaccccctg
gccatagacctccttggaagaatgctggtactagacagcgaccagagggtcagtgcggcc
gaagccttggcccacgcatacttcagccagtaccatgaccctgacgatgagccagaggca
gagccctatgatgaaagtgttgaggccaaggagcgcacgctggaggagtggaaggagctt
acttaccaagaagtccttagcttcaagcccctggaaccctcacagctccctggcacccat
gaaattgagcagtga

KEGG   Mus musculus (mouse): 26414
Entry
26414             CDS       T01002                                 

Gene name
Mapk10, C230008H04Rik, JNK, JNK3, JNK3B1, JNK3B2, SAPK(beta), Ser, Serk2, p493F1, p493F12, p54bSAPK
Definition
(RefSeq) mitogen-activated protein kinase 10
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04024  cAMP signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04310  Wnt signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04910  Insulin signaling pathway
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04926  Relaxin signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05231  Choline metabolism in cancer
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    26414 (Mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26414 (Mapk10)
   04012 ErbB signaling pathway
    26414 (Mapk10)
   04014 Ras signaling pathway
    26414 (Mapk10)
   04310 Wnt signaling pathway
    26414 (Mapk10)
   04668 TNF signaling pathway
    26414 (Mapk10)
   04068 FoxO signaling pathway
    26414 (Mapk10)
   04071 Sphingolipid signaling pathway
    26414 (Mapk10)
   04024 cAMP signaling pathway
    26414 (Mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    26414 (Mapk10)
   04137 Mitophagy - animal
    26414 (Mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    26414 (Mapk10)
   04215 Apoptosis - multiple species
    26414 (Mapk10)
   04217 Necroptosis
    26414 (Mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    26414 (Mapk10)
   04530 Tight junction
    26414 (Mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    26414 (Mapk10)
   04621 NOD-like receptor signaling pathway
    26414 (Mapk10)
   04622 RIG-I-like receptor signaling pathway
    26414 (Mapk10)
   04625 C-type lectin receptor signaling pathway
    26414 (Mapk10)
   04660 T cell receptor signaling pathway
    26414 (Mapk10)
   04658 Th1 and Th2 cell differentiation
    26414 (Mapk10)
   04659 Th17 cell differentiation
    26414 (Mapk10)
   04657 IL-17 signaling pathway
    26414 (Mapk10)
   04664 Fc epsilon RI signaling pathway
    26414 (Mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    26414 (Mapk10)
   04920 Adipocytokine signaling pathway
    26414 (Mapk10)
   04912 GnRH signaling pathway
    26414 (Mapk10)
   04914 Progesterone-mediated oocyte maturation
    26414 (Mapk10)
   04917 Prolactin signaling pathway
    26414 (Mapk10)
   04926 Relaxin signaling pathway
    26414 (Mapk10)
   04935 Growth hormone synthesis, secretion and action
    26414 (Mapk10)
  09156 Nervous system
   04728 Dopaminergic synapse
    26414 (Mapk10)
   04723 Retrograde endocannabinoid signaling
    26414 (Mapk10)
   04722 Neurotrophin signaling pathway
    26414 (Mapk10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    26414 (Mapk10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    26414 (Mapk10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    26414 (Mapk10)
   05231 Choline metabolism in cancer
    26414 (Mapk10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    26414 (Mapk10)
   05212 Pancreatic cancer
    26414 (Mapk10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    26414 (Mapk10)
   05170 Human immunodeficiency virus 1 infection
    26414 (Mapk10)
   05161 Hepatitis B
    26414 (Mapk10)
   05171 Coronavirus disease - COVID-19
    26414 (Mapk10)
   05162 Measles
    26414 (Mapk10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    26414 (Mapk10)
   05169 Epstein-Barr virus infection
    26414 (Mapk10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26414 (Mapk10)
   05135 Yersinia infection
    26414 (Mapk10)
   05133 Pertussis
    26414 (Mapk10)
   05152 Tuberculosis
    26414 (Mapk10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    26414 (Mapk10)
   05142 Chagas disease
    26414 (Mapk10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26414 (Mapk10)
   05012 Parkinson disease
    26414 (Mapk10)
   05016 Huntington disease
    26414 (Mapk10)
   05017 Spinocerebellar ataxia
    26414 (Mapk10)
   05020 Prion disease
    26414 (Mapk10)
   05022 Pathways of neurodegeneration - multiple diseases
    26414 (Mapk10)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    26414 (Mapk10)
   05418 Fluid shear stress and atherosclerosis
    26414 (Mapk10)
   05415 Diabetic cardiomyopathy
    26414 (Mapk10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    26414 (Mapk10)
   04932 Non-alcoholic fatty liver disease
    26414 (Mapk10)
   04931 Insulin resistance
    26414 (Mapk10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    26414 (Mapk10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    26414 (Mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26414 (Mapk10)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     26414 (Mapk10)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   26414 (Mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like RIO1 APH FTA2 TCAD9
Other DBs
NCBI-GeneID: 26414
NCBI-ProteinID: NP_001297615
MGI: 1346863
Ensembl: ENSMUSG00000046709
Vega: OTTMUSG00000016343
UniProt: Q61831 Q78GB8
Position
5; 5 E5
AA seq 384 aa
MSKSKVDNQFYSVEVGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSK
MLVIDPAKRISVDDALQHPYINVWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEV
MNSEEKTKNGVVKGQPSPSAQVQQ
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgagcaaaagcaaggtggacaaccagttctacagtgtggaagtgggggactcaaccttc
accgttcttaagcgctaccagaacctgaagccaattggctctggggctcagggaatagtc
tgtgctgcgtacgacgctgtccttgacagaaatgtggccattaagaagctcagcagaccc
ttccagaaccaaactcacgccaagagggcttaccgggagctggtcctcatgaagtgtgtg
aaccataaaaacattattagcttattaaatgtttttacaccccagaaaacactggaggag
ttccaagatgtctacttagtgatggaactgatggacgccaacctgtgtcaggtgattcag
atggagctggaccacgagcggatgtcttacttgctgtaccagatgctgtgtggcatcaag
cacctccactccgctgggatcatccacagggacttaaaacccagtaacattgtagtcaag
tctgattgcacactgaaaatcctcgacttcggactggccaggacagcgggtacaagcttc
atgatgactccgtatgtggtgacgcgatattacagagcccctgaggtcatcctgggcatg
ggctacaaggagaacgtggacatatggtctgtgggatgcatcatgggagaaatggttcgc
cacaaaatcctctttcccggaagggactatattgaccagtggaacaaagtcatcgagcag
ctaggaactccgtgtccagagttcatgaagaaattgcagcccacagtcagaaactacgtg
gagaatcggcccaagtacgcaggactcaccttccccaagctctttccagattccctcttc
ccagcggattctgagcacaataaacttaaagccagccaagccagggatttgttgtctaag
atgttagtgattgacccagcgaagaggatatcggtggacgacgcactgcagcatccgtac
atcaacgtttggtacgacccggctgaagtggaggcgcctccgcctcagatatatgataag
cagctggatgaaagggagcacaccatcgaagaatggaaagaacttatctacaaggaggta
atgaactcagaagagaagactaagaatggcgtagtcaaaggccagccctcgccttcagca
caggtgcagcagtga

KEGG   Mus musculus (mouse): 26415
Entry
26415             CDS       T01002                                 

Gene name
Mapk13, SA, SAPK4, Ser, Serk4
Definition
(RefSeq) mitogen-activated protein kinase 13
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04015  Rap1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04714  Thermogenesis
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu05014  Amyotrophic lateral sclerosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05205  Proteoglycans in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26415 (Mapk13)
   04015 Rap1 signaling pathway
    26415 (Mapk13)
   04370 VEGF signaling pathway
    26415 (Mapk13)
   04668 TNF signaling pathway
    26415 (Mapk13)
   04068 FoxO signaling pathway
    26415 (Mapk13)
   04071 Sphingolipid signaling pathway
    26415 (Mapk13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    26415 (Mapk13)
   04218 Cellular senescence
    26415 (Mapk13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    26415 (Mapk13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    26415 (Mapk13)
   04613 Neutrophil extracellular trap formation
    26415 (Mapk13)
   04620 Toll-like receptor signaling pathway
    26415 (Mapk13)
   04621 NOD-like receptor signaling pathway
    26415 (Mapk13)
   04622 RIG-I-like receptor signaling pathway
    26415 (Mapk13)
   04625 C-type lectin receptor signaling pathway
    26415 (Mapk13)
   04660 T cell receptor signaling pathway
    26415 (Mapk13)
   04658 Th1 and Th2 cell differentiation
    26415 (Mapk13)
   04659 Th17 cell differentiation
    26415 (Mapk13)
   04657 IL-17 signaling pathway
    26415 (Mapk13)
   04664 Fc epsilon RI signaling pathway
    26415 (Mapk13)
   04670 Leukocyte transendothelial migration
    26415 (Mapk13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    26415 (Mapk13)
   04914 Progesterone-mediated oocyte maturation
    26415 (Mapk13)
   04917 Prolactin signaling pathway
    26415 (Mapk13)
   04926 Relaxin signaling pathway
    26415 (Mapk13)
   04935 Growth hormone synthesis, secretion and action
    26415 (Mapk13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    26415 (Mapk13)
  09156 Nervous system
   04728 Dopaminergic synapse
    26415 (Mapk13)
   04723 Retrograde endocannabinoid signaling
    26415 (Mapk13)
   04722 Neurotrophin signaling pathway
    26415 (Mapk13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    26415 (Mapk13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    26415 (Mapk13)
  09159 Environmental adaptation
   04714 Thermogenesis
    26415 (Mapk13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    26415 (Mapk13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    26415 (Mapk13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    26415 (Mapk13)
   05161 Hepatitis B
    26415 (Mapk13)
   05171 Coronavirus disease - COVID-19
    26415 (Mapk13)
   05163 Human cytomegalovirus infection
    26415 (Mapk13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    26415 (Mapk13)
   05169 Epstein-Barr virus infection
    26415 (Mapk13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26415 (Mapk13)
   05135 Yersinia infection
    26415 (Mapk13)
   05133 Pertussis
    26415 (Mapk13)
   05152 Tuberculosis
    26415 (Mapk13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    26415 (Mapk13)
   05140 Leishmaniasis
    26415 (Mapk13)
   05142 Chagas disease
    26415 (Mapk13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    26415 (Mapk13)
   05020 Prion disease
    26415 (Mapk13)
   05022 Pathways of neurodegeneration - multiple diseases
    26415 (Mapk13)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    26415 (Mapk13)
   05418 Fluid shear stress and atherosclerosis
    26415 (Mapk13)
   05415 Diabetic cardiomyopathy
    26415 (Mapk13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    26415 (Mapk13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    26415 (Mapk13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26415 (Mapk13)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     26415 (Mapk13)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   26415 (Mapk13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Kinase-like Kdo FTA2 SSXRD
Other DBs
NCBI-GeneID: 26415
NCBI-ProteinID: NP_036080
MGI: 1346864
Ensembl: ENSMUSG00000004864
Vega: OTTMUSG00000024249
UniProt: Q9Z1B7 Q3UIB2
Position
17; 17 A3.3
AA seq 366 aa
MSLTRKRGFYKQDINKTAWELPKTYLAPAHVGSGAYGAVCSAIDKRTGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMHHENVIGLLDVFTPASSLRSFHDFYLVMPFMQTDLQKIMGM
EFSEDKVQYLVYQMLKGLKYIHSAGIVHRDLKPGNLAVNEDCELKILDFGLARHTDTEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGAEFVQKLKDKAAKSYIQSLPQSPKKDFTQLFPRASPQAADLLDKMLELDVDKRLTAA
QALAHPFFEPFRDPEEETEAQQPFDDALEHEKLSVDEWKQHIYKEISNFSPIARKDSRRR
SGMKLQ
NT seq 1101 nt   +upstreamnt  +downstreamnt
atgagcctcactcggaaaaggggcttctacaagcaggacatcaacaagactgcctgggag
ctacccaagacctacctggcgcccgcgcacgtcggcagcggggcctatggagcggtgtgc
tcggccatcgacaagcggacaggggagaaggtggccatcaagaagctgagccggcccttc
cagtcggagatctttgccaagcgcgcttaccgcgagcttctgctcttgaagcacatgcac
catgagaacgtcattgggcttctggatgtcttcacccctgcgtcttcccttcggagcttc
catgatttctacctggtgatgcccttcatgcagacagacctacagaagatcatggggatg
gaattcagcgaggataaggtccagtacttggtgtaccagatgctcaaaggtctaaagtac
atccactccgctggcatcgtccacagggacctgaaaccgggcaacctggctgtgaatgaa
gactgtgagctgaagatcctggactttgggctggcccgccacacagacactgagatgacg
ggctatgtggtgacccgctggtaccgggcccccgaggtgatcctcagctggatgcattac
aaccagacagtcgacatctggtctgttggttgcatcatggcagaaatgctgactggaaag
acactcttcaagggcaaggactacctggaccagctgacccagatcctgaaagtgactggg
gtgccaggtgccgagttcgtgcagaagctgaaagacaaggcggccaaatcctatattcag
tccctgccccagagccccaagaaggatttcacacagctcttcccacgcgccagtccgcaa
gctgcagacctgctcgacaagatgctggagctggatgtggacaagcgtctgaccgctgct
caggcactggctcaccccttctttgaacccttccgggaccctgaggaggagacagaggcc
cagcagccttttgatgatgccttagaacatgagaaactcagcgtggacgaatggaaacaa
cacatctacaaagagatctcaaacttcagtcccatagcccggaaggactcacggcgacga
agtggcatgaagctgcagtga

KEGG   Mus musculus (mouse): 26416
Entry
26416             CDS       T01002                                 

Gene name
Mapk14, CSB, CSBP2, Crk, Crk1, Csbp1, Mxi, Mxi2, PRKM14, PRKM15, p3, p38, p38-, p38-alpha, p38M, p38MAPK, p38a, p38alpha
Definition
(RefSeq) mitogen-activated protein kinase 14
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04015  Rap1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04714  Thermogenesis
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu05014  Amyotrophic lateral sclerosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05205  Proteoglycans in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26416 (Mapk14)
   04015 Rap1 signaling pathway
    26416 (Mapk14)
   04370 VEGF signaling pathway
    26416 (Mapk14)
   04668 TNF signaling pathway
    26416 (Mapk14)
   04068 FoxO signaling pathway
    26416 (Mapk14)
   04071 Sphingolipid signaling pathway
    26416 (Mapk14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    26416 (Mapk14)
   04218 Cellular senescence
    26416 (Mapk14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    26416 (Mapk14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    26416 (Mapk14)
   04613 Neutrophil extracellular trap formation
    26416 (Mapk14)
   04620 Toll-like receptor signaling pathway
    26416 (Mapk14)
   04621 NOD-like receptor signaling pathway
    26416 (Mapk14)
   04622 RIG-I-like receptor signaling pathway
    26416 (Mapk14)
   04625 C-type lectin receptor signaling pathway
    26416 (Mapk14)
   04660 T cell receptor signaling pathway
    26416 (Mapk14)
   04658 Th1 and Th2 cell differentiation
    26416 (Mapk14)
   04659 Th17 cell differentiation
    26416 (Mapk14)
   04657 IL-17 signaling pathway
    26416 (Mapk14)
   04664 Fc epsilon RI signaling pathway
    26416 (Mapk14)
   04670 Leukocyte transendothelial migration
    26416 (Mapk14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    26416 (Mapk14)
   04914 Progesterone-mediated oocyte maturation
    26416 (Mapk14)
   04917 Prolactin signaling pathway
    26416 (Mapk14)
   04926 Relaxin signaling pathway
    26416 (Mapk14)
   04935 Growth hormone synthesis, secretion and action
    26416 (Mapk14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    26416 (Mapk14)
  09156 Nervous system
   04728 Dopaminergic synapse
    26416 (Mapk14)
   04723 Retrograde endocannabinoid signaling
    26416 (Mapk14)
   04722 Neurotrophin signaling pathway
    26416 (Mapk14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    26416 (Mapk14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    26416 (Mapk14)
  09159 Environmental adaptation
   04714 Thermogenesis
    26416 (Mapk14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    26416 (Mapk14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    26416 (Mapk14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    26416 (Mapk14)
   05161 Hepatitis B
    26416 (Mapk14)
   05171 Coronavirus disease - COVID-19
    26416 (Mapk14)
   05163 Human cytomegalovirus infection
    26416 (Mapk14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    26416 (Mapk14)
   05169 Epstein-Barr virus infection
    26416 (Mapk14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26416 (Mapk14)
   05135 Yersinia infection
    26416 (Mapk14)
   05133 Pertussis
    26416 (Mapk14)
   05152 Tuberculosis
    26416 (Mapk14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    26416 (Mapk14)
   05140 Leishmaniasis
    26416 (Mapk14)
   05142 Chagas disease
    26416 (Mapk14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    26416 (Mapk14)
   05020 Prion disease
    26416 (Mapk14)
   05022 Pathways of neurodegeneration - multiple diseases
    26416 (Mapk14)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    26416 (Mapk14)
   05418 Fluid shear stress and atherosclerosis
    26416 (Mapk14)
   05415 Diabetic cardiomyopathy
    26416 (Mapk14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    26416 (Mapk14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    26416 (Mapk14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26416 (Mapk14)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     26416 (Mapk14)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   26416 (Mapk14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 26416
NCBI-ProteinID: NP_001161980
MGI: 1346865
Ensembl: ENSMUSG00000053436
Vega: OTTMUSG00000020086
UniProt: P47811 Q5U421
Structure
PDB: 

Position
17 A3.3; 17 14.85 cM
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtcgcaggagaggcccacgttctaccggcaggagctgaacaagaccatctgggaggtg
cccgaacgataccagaacctgtccccggtgggctcgggcgcctatggctcggtgtgtgct
gcttttgatacaaagacggggcatcgtgtggcagttaagaagctgtcgagaccgtttcag
tccatcattcacgccaaaaggacctaccgagagttgcgtctgctgaagcacatgaaacac
gaaaatgtgattggtctgttggatgtgttcacacccgcaaggtcactggaggaattcaat
gacgtgtacctggtgacccatctcatgggggcggacctgaacaacatcgtgaagtgccag
aagctgaccgacgaccacgttcagtttctcatctaccagatcctccgagggctgaagtat
atacattcggctgacataattcacagggacctaaagcccagcaacctagctgtgaacgaa
gactgtgagctcaagattctggattttgggctggctcggcacactgatgatgagatgaca
ggctacgtggctaccaggtggtaccgagccccagagatcatgctgaattggatgcactat
aaccagacagtggatatttggtccgtgggctgcatcatggctgagctgttgaccggaaga
acgttgtttcctggtacagaccatattaaccagcttcagcagataatgcgtctgacgggg
acaccccctgcttatctcattaacaggatgccaagccatgaggcaagaaactacattcag
tctctggcccagatgccgaagatgaacttcgcaaatgtatttattggtgccaatcccctg
gctgtcgacctactggagaagatgctcgttttggactcagataagaggatcacagcagcc
caagctcttgcgcatgcctactttgctcagtaccacgaccctgatgatgagcctgttgct
gacccttatgaccagtcctttgaaagcagggaccttctcatagatgagtggaagagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagaaatggagtcc
tga

KEGG   Mus musculus (mouse): 26419
Entry
26419             CDS       T01002                                 

Gene name
Mapk8, AI849689, JNK, JNK1, Prk, Prkm8, SAPK1
Definition
(RefSeq) mitogen-activated protein kinase 8
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04024  cAMP signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04310  Wnt signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04910  Insulin signaling pathway
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04926  Relaxin signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05231  Choline metabolism in cancer
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    26419 (Mapk8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26419 (Mapk8)
   04012 ErbB signaling pathway
    26419 (Mapk8)
   04014 Ras signaling pathway
    26419 (Mapk8)
   04310 Wnt signaling pathway
    26419 (Mapk8)
   04668 TNF signaling pathway
    26419 (Mapk8)
   04068 FoxO signaling pathway
    26419 (Mapk8)
   04071 Sphingolipid signaling pathway
    26419 (Mapk8)
   04024 cAMP signaling pathway
    26419 (Mapk8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    26419 (Mapk8)
   04137 Mitophagy - animal
    26419 (Mapk8)
  09143 Cell growth and death
   04210 Apoptosis
    26419 (Mapk8)
   04215 Apoptosis - multiple species
    26419 (Mapk8)
   04217 Necroptosis
    26419 (Mapk8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    26419 (Mapk8)
   04530 Tight junction
    26419 (Mapk8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    26419 (Mapk8)
   04621 NOD-like receptor signaling pathway
    26419 (Mapk8)
   04622 RIG-I-like receptor signaling pathway
    26419 (Mapk8)
   04625 C-type lectin receptor signaling pathway
    26419 (Mapk8)
   04660 T cell receptor signaling pathway
    26419 (Mapk8)
   04658 Th1 and Th2 cell differentiation
    26419 (Mapk8)
   04659 Th17 cell differentiation
    26419 (Mapk8)
   04657 IL-17 signaling pathway
    26419 (Mapk8)
   04664 Fc epsilon RI signaling pathway
    26419 (Mapk8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    26419 (Mapk8)
   04920 Adipocytokine signaling pathway
    26419 (Mapk8)
   04912 GnRH signaling pathway
    26419 (Mapk8)
   04914 Progesterone-mediated oocyte maturation
    26419 (Mapk8)
   04917 Prolactin signaling pathway
    26419 (Mapk8)
   04926 Relaxin signaling pathway
    26419 (Mapk8)
   04935 Growth hormone synthesis, secretion and action
    26419 (Mapk8)
  09156 Nervous system
   04728 Dopaminergic synapse
    26419 (Mapk8)
   04723 Retrograde endocannabinoid signaling
    26419 (Mapk8)
   04722 Neurotrophin signaling pathway
    26419 (Mapk8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    26419 (Mapk8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    26419 (Mapk8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    26419 (Mapk8)
   05231 Choline metabolism in cancer
    26419 (Mapk8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    26419 (Mapk8)
   05212 Pancreatic cancer
    26419 (Mapk8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    26419 (Mapk8)
   05170 Human immunodeficiency virus 1 infection
    26419 (Mapk8)
   05161 Hepatitis B
    26419 (Mapk8)
   05171 Coronavirus disease - COVID-19
    26419 (Mapk8)
   05162 Measles
    26419 (Mapk8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    26419 (Mapk8)
   05169 Epstein-Barr virus infection
    26419 (Mapk8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26419 (Mapk8)
   05135 Yersinia infection
    26419 (Mapk8)
   05133 Pertussis
    26419 (Mapk8)
   05152 Tuberculosis
    26419 (Mapk8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    26419 (Mapk8)
   05142 Chagas disease
    26419 (Mapk8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26419 (Mapk8)
   05012 Parkinson disease
    26419 (Mapk8)
   05016 Huntington disease
    26419 (Mapk8)
   05017 Spinocerebellar ataxia
    26419 (Mapk8)
   05020 Prion disease
    26419 (Mapk8)
   05022 Pathways of neurodegeneration - multiple diseases
    26419 (Mapk8)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    26419 (Mapk8)
   05418 Fluid shear stress and atherosclerosis
    26419 (Mapk8)
   05415 Diabetic cardiomyopathy
    26419 (Mapk8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    26419 (Mapk8)
   04932 Non-alcoholic fatty liver disease
    26419 (Mapk8)
   04931 Insulin resistance
    26419 (Mapk8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    26419 (Mapk8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    26419 (Mapk8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26419 (Mapk8)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     26419 (Mapk8)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   26419 (Mapk8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo ABC1 Kinase-like RIO1 APH FTA2 TCAD9
Other DBs
NCBI-GeneID: 26419
NCBI-ProteinID: NP_057909
MGI: 1346861
Ensembl: ENSMUSG00000021936
Vega: OTTMUSG00000018229
UniProt: Q91Y86 Q544A0
Position
14; 14 B
AA seq 384 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLAQVQQ
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgagcagaagcaaacgtgacaacaatttttatagtgtagagattggagattctacattc
acagtcctaaaacgataccagaatttaaagcctataggctcaggagctcaaggaatagtg
tgtgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctcagccggcca
tttcagaatcagacccatgctaagcgcgcctaccgagaactagttcttatgaagtgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagttagatcatgaaagaatgtcctaccttctctatcaaatgctgtgtggaatcaag
caccttcactctgctggaattattcatcgggacttaaagcctagtaatatagtagtcaaa
tcagactgcactttgaagattcttgattttggactggcgaggactgcaggaacgagtttt
atgatgacgccttatgtggtgactcgctactacagagcaccagaggtcattctcggcatg
ggctacaaggagaacgtggacttatggtctgtggggtgcattatgggagaaatggtttgc
cacaaaatcctctttccaggaagggactatattgatcagtggaataaagttattgaacag
ctcggaacaccttgtcctgaattcatgaagaaactacaaccaacagtaaggacttatgtt
gaaaacaggcctaaatacgctggatatagctttgagaaactgttccccgatgtgcttttc
ccagctgactcagagcataacaaacttaaagccagtcaggcaagagatttgttatccaaa
atgctagtaatagatgcatccaaaaggatctccgtagatgaagctctccagcacccatac
atcaacgtctggtatgatccttcagaagcagaagccccaccaccaaagatcccggacaag
cagttagatgagagggagcacacaatagaggagtggaaagaactgatatacaaggaggta
atggatttggaggaacgaactaagaatggagtcataagagggcagccgtctcctttagca
caggtgcagcaatga

KEGG   Mus musculus (mouse): 26420
Entry
26420             CDS       T01002                                 

Gene name
Mapk9, AI851083, JNK, JNK2, Prk, Prkm9, p54aSAPK
Definition
(RefSeq) mitogen-activated protein kinase 9
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04012  ErbB signaling pathway
mmu04014  Ras signaling pathway
mmu04024  cAMP signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04137  Mitophagy - animal
mmu04140  Autophagy - animal
mmu04141  Protein processing in endoplasmic reticulum
mmu04210  Apoptosis
mmu04215  Apoptosis - multiple species
mmu04217  Necroptosis
mmu04310  Wnt signaling pathway
mmu04380  Osteoclast differentiation
mmu04510  Focal adhesion
mmu04530  Tight junction
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04910  Insulin signaling pathway
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04926  Relaxin signaling pathway
mmu04930  Type II diabetes mellitus
mmu04931  Insulin resistance
mmu04932  Non-alcoholic fatty liver disease
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05162  Measles
mmu05166  Human T-cell leukemia virus 1 infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05200  Pathways in cancer
mmu05210  Colorectal cancer
mmu05212  Pancreatic cancer
mmu05231  Choline metabolism in cancer
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    26420 (Mapk9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    26420 (Mapk9)
   04012 ErbB signaling pathway
    26420 (Mapk9)
   04014 Ras signaling pathway
    26420 (Mapk9)
   04310 Wnt signaling pathway
    26420 (Mapk9)
   04668 TNF signaling pathway
    26420 (Mapk9)
   04068 FoxO signaling pathway
    26420 (Mapk9)
   04071 Sphingolipid signaling pathway
    26420 (Mapk9)
   04024 cAMP signaling pathway
    26420 (Mapk9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    26420 (Mapk9)
   04137 Mitophagy - animal
    26420 (Mapk9)
  09143 Cell growth and death
   04210 Apoptosis
    26420 (Mapk9)
   04215 Apoptosis - multiple species
    26420 (Mapk9)
   04217 Necroptosis
    26420 (Mapk9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    26420 (Mapk9)
   04530 Tight junction
    26420 (Mapk9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    26420 (Mapk9)
   04621 NOD-like receptor signaling pathway
    26420 (Mapk9)
   04622 RIG-I-like receptor signaling pathway
    26420 (Mapk9)
   04625 C-type lectin receptor signaling pathway
    26420 (Mapk9)
   04660 T cell receptor signaling pathway
    26420 (Mapk9)
   04658 Th1 and Th2 cell differentiation
    26420 (Mapk9)
   04659 Th17 cell differentiation
    26420 (Mapk9)
   04657 IL-17 signaling pathway
    26420 (Mapk9)
   04664 Fc epsilon RI signaling pathway
    26420 (Mapk9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    26420 (Mapk9)
   04920 Adipocytokine signaling pathway
    26420 (Mapk9)
   04912 GnRH signaling pathway
    26420 (Mapk9)
   04914 Progesterone-mediated oocyte maturation
    26420 (Mapk9)
   04917 Prolactin signaling pathway
    26420 (Mapk9)
   04926 Relaxin signaling pathway
    26420 (Mapk9)
   04935 Growth hormone synthesis, secretion and action
    26420 (Mapk9)
  09156 Nervous system
   04728 Dopaminergic synapse
    26420 (Mapk9)
   04723 Retrograde endocannabinoid signaling
    26420 (Mapk9)
   04722 Neurotrophin signaling pathway
    26420 (Mapk9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    26420 (Mapk9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    26420 (Mapk9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    26420 (Mapk9)
   05231 Choline metabolism in cancer
    26420 (Mapk9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    26420 (Mapk9)
   05212 Pancreatic cancer
    26420 (Mapk9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    26420 (Mapk9)
   05170 Human immunodeficiency virus 1 infection
    26420 (Mapk9)
   05161 Hepatitis B
    26420 (Mapk9)
   05171 Coronavirus disease - COVID-19
    26420 (Mapk9)
   05162 Measles
    26420 (Mapk9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    26420 (Mapk9)
   05169 Epstein-Barr virus infection
    26420 (Mapk9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    26420 (Mapk9)
   05135 Yersinia infection
    26420 (Mapk9)
   05133 Pertussis
    26420 (Mapk9)
   05152 Tuberculosis
    26420 (Mapk9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    26420 (Mapk9)
   05142 Chagas disease
    26420 (Mapk9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26420 (Mapk9)
   05012 Parkinson disease
    26420 (Mapk9)
   05016 Huntington disease
    26420 (Mapk9)
   05017 Spinocerebellar ataxia
    26420 (Mapk9)
   05020 Prion disease
    26420 (Mapk9)
   05022 Pathways of neurodegeneration - multiple diseases
    26420 (Mapk9)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    26420 (Mapk9)
   05418 Fluid shear stress and atherosclerosis
    26420 (Mapk9)
   05415 Diabetic cardiomyopathy
    26420 (Mapk9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    26420 (Mapk9)
   04932 Non-alcoholic fatty liver disease
    26420 (Mapk9)
   04931 Insulin resistance
    26420 (Mapk9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    26420 (Mapk9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    26420 (Mapk9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    26420 (Mapk9)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     26420 (Mapk9)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   26420 (Mapk9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 26420
NCBI-ProteinID: NP_001157143
MGI: 1346862
Ensembl: ENSMUSG00000020366
Vega: OTTMUSG00000005569
UniProt: Q9WTU6 Q8C094
Position
11; 11 B1.2
AA seq 423 aa
MSDSKSDGQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMAEMVLHKVLFPGRDYIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVKDQPSDAAVSSKATPSQSSSINDISSMSTEHTLASDTDSSLDASTGPLE
GCR
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaaagcgatggtcagttttacagtgtgcaggtggcggactcaactttc
actgttctaaaacgttaccagcaactgaaaccgatcggctctggagcccaaggaattgtt
tgtgctgcttttgatacagttcttgggataaatgtggctgtcaagaagttaagtcgtcct
tttcagaaccaaacgcacgcaaagagagcctaccgtgaactcgtcctcttaaagtgtgtc
aatcataaaaacataattagcttgttaaatgtgttcacaccacaaaaaacgctagaagaa
tttcaagatgtgtacttggtaatggaactaatggatgctaacttatgtcaggttattcat
atggaactggaccatgagagaatgtcctaccttctctaccagatgctctgtggcatcaag
catctgcattcagctggtatcattcatagagatttgaagcctagcaacattgtagtaaaa
tcagactgtaccctcaagatccttgactttggcctggcgcgaacagcctgtaccaacttt
atgatgactccctatgtggtaactcgatactatcgggctccagaagtcatcctgggcatg
ggctacaaagagaatgtggacatctggtctgtcgggtgcatcatggcagaaatggtcctc
cataaagtcctgttcccaggaagagactatattgatcaatggaataaagttattgaacag
ctaggaacaccatccgcagagttcatgaagaaacttcagccaactgtaaggaattatgtg
gaaaacagaccaaagtaccctggaatcaagtttgaagagctctttccagattggatattt
ccgtcagaatctgagagagacaaaataaaaacaagtcaagccagagatctgttatcaaaa
atgctagtgattgatccagacaagcggatctctgtggacgaagccttgcgccacccgtat
attactgtttggtatgaccccgctgaagcagaagcgccaccacctcaaatttatgatgcc
cagttggaagaaagagagcatgcgattgaagagtggaaagagctaatttacaaagaagtg
atggactgggaagaaagaagcaagaatggggtaaaagaccagccttcagatgcagcagta
agtagcaaggctactccttctcagtcgtcatccatcaatgacatctcatccatgtccact
gagcacaccctggcctcagacacagacagcagtctcgatgcctcaacaggacccctggaa
ggctgccggtga

KEGG   Mus musculus (mouse): 29857
Entry
29857             CDS       T01002                                 

Gene name
Mapk12, AW123708, Erk, Erk6, P38ga, P38gamma, Prkm, Prkm12, Sa, Sapk3
Definition
(RefSeq) mitogen-activated protein kinase 12
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04015  Rap1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04114  Oocyte meiosis
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04613  Neutrophil extracellular trap formation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04714  Thermogenesis
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu04935  Growth hormone synthesis, secretion and action
mmu05014  Amyotrophic lateral sclerosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05135  Yersinia infection
mmu05140  Leishmaniasis
mmu05142  Chagas disease
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05161  Hepatitis B
mmu05163  Human cytomegalovirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05170  Human immunodeficiency virus 1 infection
mmu05171  Coronavirus disease - COVID-19
mmu05205  Proteoglycans in cancer
mmu05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
mmu05415  Diabetic cardiomyopathy
mmu05417  Lipid and atherosclerosis
mmu05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    29857 (Mapk12)
   04015 Rap1 signaling pathway
    29857 (Mapk12)
   04370 VEGF signaling pathway
    29857 (Mapk12)
   04668 TNF signaling pathway
    29857 (Mapk12)
   04068 FoxO signaling pathway
    29857 (Mapk12)
   04071 Sphingolipid signaling pathway
    29857 (Mapk12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    29857 (Mapk12)
   04218 Cellular senescence
    29857 (Mapk12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    29857 (Mapk12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    29857 (Mapk12)
   04613 Neutrophil extracellular trap formation
    29857 (Mapk12)
   04620 Toll-like receptor signaling pathway
    29857 (Mapk12)
   04621 NOD-like receptor signaling pathway
    29857 (Mapk12)
   04622 RIG-I-like receptor signaling pathway
    29857 (Mapk12)
   04625 C-type lectin receptor signaling pathway
    29857 (Mapk12)
   04660 T cell receptor signaling pathway
    29857 (Mapk12)
   04658 Th1 and Th2 cell differentiation
    29857 (Mapk12)
   04659 Th17 cell differentiation
    29857 (Mapk12)
   04657 IL-17 signaling pathway
    29857 (Mapk12)
   04664 Fc epsilon RI signaling pathway
    29857 (Mapk12)
   04670 Leukocyte transendothelial migration
    29857 (Mapk12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    29857 (Mapk12)
   04914 Progesterone-mediated oocyte maturation
    29857 (Mapk12)
   04917 Prolactin signaling pathway
    29857 (Mapk12)
   04926 Relaxin signaling pathway
    29857 (Mapk12)
   04935 Growth hormone synthesis, secretion and action
    29857 (Mapk12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    29857 (Mapk12)
  09156 Nervous system
   04728 Dopaminergic synapse
    29857 (Mapk12)
   04723 Retrograde endocannabinoid signaling
    29857 (Mapk12)
   04722 Neurotrophin signaling pathway
    29857 (Mapk12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    29857 (Mapk12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    29857 (Mapk12)
  09159 Environmental adaptation
   04714 Thermogenesis
    29857 (Mapk12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    29857 (Mapk12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    29857 (Mapk12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    29857 (Mapk12)
   05161 Hepatitis B
    29857 (Mapk12)
   05171 Coronavirus disease - COVID-19
    29857 (Mapk12)
   05163 Human cytomegalovirus infection
    29857 (Mapk12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    29857 (Mapk12)
   05169 Epstein-Barr virus infection
    29857 (Mapk12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    29857 (Mapk12)
   05135 Yersinia infection
    29857 (Mapk12)
   05133 Pertussis
    29857 (Mapk12)
   05152 Tuberculosis
    29857 (Mapk12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    29857 (Mapk12)
   05140 Leishmaniasis
    29857 (Mapk12)
   05142 Chagas disease
    29857 (Mapk12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    29857 (Mapk12)
   05020 Prion disease
    29857 (Mapk12)
   05022 Pathways of neurodegeneration - multiple diseases
    29857 (Mapk12)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    29857 (Mapk12)
   05418 Fluid shear stress and atherosclerosis
    29857 (Mapk12)
   05415 Diabetic cardiomyopathy
    29857 (Mapk12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    29857 (Mapk12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    29857 (Mapk12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    29857 (Mapk12)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     29857 (Mapk12)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   29857 (Mapk12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH Kdo Kinase-like Haspin_kinase UvrD_C
Other DBs
NCBI-GeneID: 29857
NCBI-ProteinID: NP_038899
MGI: 1353438
Ensembl: ENSMUSG00000022610
UniProt: O08911
Position
15; 15 E3
AA seq 367 aa
MSSPPPARKGFYRQEVTKTAWEVRAVYQDLQPVGSGAYGAVCSAVDSRTGNKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDESLDDFTDFYLVMPFMGTDLGKLM
KHETLSEDRIQFLVYQMLKGLKYIHAAGVIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKILFKGNDHLDQLKEIMK
ITGTPPPEFVQKLQSAEAKNYMEGLPELEKKDFASVLTNASPQAVNLLERMLVLDAEQRV
TAAEALTHPYFESLRDTEDEPKAQKYDDSFDDVDRTLEEWKRVTYKEVLSFKPPRQLGAR
VPKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctccccgccacccgcccgcaagggcttttaccgccaggaggtgaccaaaacggcc
tgggaggtgcgcgccgtgtaccaagacctgcagcccgttggctctggtgcctatggtgca
gtgtgctctgcagtagacagccgcactggcaacaaggtggccatcaagaagttgtaccgg
cccttccagtcggagctgtttgccaagcgcgcctacagagagttgcgcctcctcaaacac
atgcgccacgagaacgtcattgggctactggatgtgttcacacctgatgagtctctggac
gacttcacagacttctacctggtgatgccattcatgggcactgatctgggcaaactcatg
aagcatgagaccctgagtgaagacagaatccagtttcttgtgtatcagatgttgaagggg
ctgaagtatatccatgcggctggtgtcatccacagagacttgaagcctggcaacctggct
gtgaatgaggactgtgagctgaagatcctagactttggccttgccaggcaggcagacagt
gagatgacaggatatgtggtaacccggtggtatcgggcaccagaggtcatcttgaattgg
atgcgctacacgcagacagtggacatttggtccgttggctgcatcatggcggagatgatt
actgggaagatcctgttcaaaggcaatgaccacctggaccagctgaaggagatcatgaag
atcacagggacgccccctcctgagtttgttcagaagctacagagtgcagaggccaagaac
tacatggaaggcctccctgagttagaaaagaaggattttgcctctgtcctgaccaacgca
agccctcaggctgtgaatctcctggaaaggatgctggtgctggatgcggaacagcgggtg
acagcagctgaggcgttaacccatccatactttgagtcccttcgggacactgaggatgaa
cccaaggcccagaaatatgacgactcctttgatgatgtagaccgcacccttgaggaatgg
aagcgtgtgacttacaaggaagttctcagcttcaagcctcctaggcagctaggagccaga
gttccaaaggagacggctctgtga

DBGET integrated database retrieval system