KEGG   Mus musculus (mouse): 19106Help
Entry
19106             CDS       T01002                                 

Gene name
Eif2ak2, 2310047A08Rik, 4732414G15Rik, AI467567, AI747578, Pkr, Prkr, Tik
Definition
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 2
  KO
K16195  eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04141  Protein processing in endoplasmic reticulum
mmu04217  Necroptosis
mmu05160  Hepatitis C
mmu05162  Measles
mmu05164  Influenza A
mmu05165  Human papillomavirus infection
mmu05167  Kaposi sarcoma-associated herpesvirus infection
mmu05168  Herpes simplex virus 1 infection
mmu05169  Epstein-Barr virus infection
mmu05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    19106 (Eif2ak2)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    19106 (Eif2ak2)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    19106 (Eif2ak2)
  09172 Infectious disease: viral
   05162 Measles
    19106 (Eif2ak2)
   05164 Influenza A
    19106 (Eif2ak2)
   05160 Hepatitis C
    19106 (Eif2ak2)
   05168 Herpes simplex virus 1 infection
    19106 (Eif2ak2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    19106 (Eif2ak2)
   05169 Epstein-Barr virus infection
    19106 (Eif2ak2)
   05165 Human papillomavirus infection
    19106 (Eif2ak2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mmu01001]
    19106 (Eif2ak2)
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19106 (Eif2ak2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:mmu03019]
    19106 (Eif2ak2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     19106 (Eif2ak2)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: Other
  PEK family [OT]
   19106 (Eif2ak2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     19106 (Eif2ak2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     19106 (Eif2ak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr dsrm Pkinase_fungal Kdo Haspin_kinase APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 19106
NCBI-ProteinID: NP_035293
MGI: 1353449
Ensembl: ENSMUSG00000024079
Vega: OTTMUSG00000036019
UniProt: Q03963
Structure
PDB: 

Position
17 E3; 17 49.56 cM
AA seq 515 aa AA seqDB search
MASDTPGFYMDKLNKYRQMHGVAITYKELSTSGPPHDRRFTFQVLIDEKEFPEAKGRSKQ
EARNAAAKLAVDILDNENKVDCHTSASEQGLFVGNYIGLVNSFAQKKKLSVNYEQCEPNS
ELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGTSSSVVTSTFS
GFSSSSSMTSNGVSQSAPGSFSSENVFTNGLGENKRKSGVKVSPDDVQRNKYTLDARFNS
DFEDIEEIGLGGFGQVFKAKHRIDGKRYAIKRVKYNTEKAEHEVQALAELNHVNIVQYHS
CWEGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQSKVDKALILDLYEQI
VTGVEYIHSKGLIHRDLKPGNIFLVDERHIKIGDFGLATALENDGKSRTRRTGTLQYMSP
EQLFLKHYGKEVDIFALGLILAELLHTCFTESEKIKFFESLRKGDFSNDIFDNKEKSLLK
KLLSEKPKDRPETSEILKTLAEWRNISEKKKRNTC
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgataccccaggtttctacatggacaaacttaataaataccgccagatgcac
ggagtagccattacgtataaagaacttagtacttcgggacctccacatgacagaaggttt
acatttcaagttttaatagatgagaaggaatttccagaagccaaaggtagatcaaagcag
gaggcaagaaacgctgcagccaaattagctgttgatatacttgataacgaaaacaaggtg
gattgtcacacgagtgcatctgagcaaggcttgttcgttggtaactacataggccttgtc
aatagctttgcccagaagaaaaagctgtctgtaaattatgaacagtgtgagcccaactct
gagttgcctcaaagatttatttgtaaatgcaaaattgggcagacaatgtatggtactggt
tcaggtgtcaccaaacaggaggcaaagcagttggctgcgaaagaagcctatcagaagctg
ttaaagagcccgccgaaaactgccggaacatcctctagcgttgtcacatctacattcagt
ggcttttccagcagctcgtctatgacaagtaatggtgtttcccagtcagcacctggaagt
ttttcctcagagaacgtgtttacgaacggtctcggagaaaataaaaggaaatcaggagta
aaagtatcccctgatgatgtgcaaagaaataaatataccttggacgccaggtttaacagc
gattttgaagacatagaagaaattggcttaggtggatttggtcaagttttcaaagcgaaa
cacagaattgatggaaagagatacgctattaagcgcgttaaatataacacggagaaggcg
gagcacgaagtacaagcgctggcagaactcaatcacgtcaacattgtccaataccatagt
tgttgggagggagttgactatgatcctgagcacagcatgagtgatacaagtcgatacaaa
acccggtgcctctttattcaaatggaattctgtgataaaggaactttggagcaatggatg
agaaacagaaatcagagtaaagtggacaaagctttgattttggacttatatgaacaaatc
gtgaccggagtggagtatatacactcgaaagggttaattcacagagatcttaagccaggt
aatatatttttagtagatgaaagacacattaagatcggagactttggccttgcaacagcc
ctggaaaatgatggaaaatcccgaacaaggagaacaggaactcttcaatacatgagtcca
gaacagttatttttaaagcactatggaaaagaagtggacatctttgctttgggccttatt
ctagctgaacttcttcacacgtgcttcacggagtcagagaaaataaagtttttcgaaagt
ctaagaaaaggcgacttctctaatgatatattcgacaacaaagaaaaaagccttctaaaa
aaactactctcagagaaacccaaggaccgacctgagacatctgaaatcctgaagaccttg
gctgaatggaggaacatctcagagaaaaagaaaagaaacacatgttag

DBGET integrated database retrieval system