KEGG   Mus musculus (mouse): 19108Help
Entry
19108             CDS       T01002                                 

Gene name
Prkx, PKX1, Pkare
Definition
(RefSeq) protein kinase, X-linked
  KO
K19584  protein kinase X [EC:2.7.11.11]
Organism
mmu  Mus musculus (mouse)
Brite
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     19108 (Prkx)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: AGC group
  PKA family
   19108 (Prkx)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 19108
NCBI-ProteinID: NP_058675
MGI: 1309999
Ensembl: ENSMUSG00000035725
Vega: OTTMUSG00000017860
UniProt: Q922R0
Position
X; X B
AA seq 355 aa AA seqDB search
MEPPAGAAATVKDPDHDPVKTKVSAPAADPKPRTSSQKAGHSLQDWDTIATVGTGTFGRV
NLVKEKTGRQYCALKIMSIPDVIRLKQEQHVQNEKAVLKEINHPFLIKLLWTGHDNRFLY
MLMEFVPGGELFTYLRNRGRFSSVASVFYATEIVCAIEYLHSKEIVYRDLKPENILLDRE
GHIKLTDFGFAKKLVDRTWTLCGTPEYLAPEVIQSKGHGRAVDWWALGILIFEMLSGFPP
FFDDNPFGIYQKILACKIDFPRQLDFTSKDLIKKLLVVDRTRRLGNMKNGAEDIKRHRWF
RGVEWESVPQRKLKPPIVPKLSGDGDISNFETYPESELDKTPSVSDKDLETFKNF
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atggagccgcccgctggtgccgcggcgaccgtaaaagatccagaccatgaccccgtgaag
accaaggtctcggcgcccgccgcggaccccaaacccaggacatcgtcacagaaggcgggg
cactcgttacaagattgggacaccatagccaccgtgggcactgggacctttggccgtgta
aacctggtgaaggagaagacaggcaggcaatactgtgccttgaagattatgagtatccca
gatgtcatccgcctgaaacaggaacagcatgtgcagaatgagaaagcagtcctgaaggaa
ataaaccatcccttcctcattaaactgctttggacaggccatgacaaccgcttcctatac
atgttgatggagttcgtgcctggtggtgagctcttcacctacctgcgtaatcgtggccga
ttctcctcagttgcttcagtcttctacgccacagagattgtgtgtgccatagaatatcta
cactcaaaggaaatcgtatacagggacctgaagcctgaaaacatccttctagacagggaa
ggacatattaaactgacagacttcggcttcgccaagaaactggtggataggacatggact
ctctgtgggacaccagaatatctcgccccagaagtcattcagagcaaaggtcatggaagg
gctgtggactggtgggcactgggcattcttatattcgagatgctgtctgggtttccccca
tttttcgatgacaacccgtttgggatttaccagaaaatccttgcatgcaaaatagatttc
cccagacaattggatttcacctctaaggacctcatcaagaagctgctggtggtggacagg
acccgacgcctaggcaacatgaagaatggggcagaagacatcaagcggcaccggtggttc
cgaggtgtggagtgggaatctgtgccacaaagaaaactgaagccacccattgtgcccaag
ttatcgggtgatggtgacatctccaactttgagacttatccagagagtgaattggacaag
acaccttctgtatctgacaaagacctggaaacattcaaaaatttctga

DBGET integrated database retrieval system