KEGG   Mus musculus (mouse): 19122
Entry
19122             CDS       T01002                                 

Gene name
Prnp, AA960666, AI325101, CD230, P, PrP, PrP<C>, PrPC, PrPSc, Prn-i, Prn-p, S, Sinc, prP27-30, prP33-35C
Definition
(RefSeq) prion protein
  KO
K05634  prion protein
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04216  Ferroptosis
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    19122 (Prnp)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    19122 (Prnp)
   05022 Pathways of neurodegeneration - multiple diseases
    19122 (Prnp)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   19122 (Prnp)
CD molecules [BR:mmu04090]
 Proteins
  19122 (Prnp)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Heparan sulfate / Heparin
  Others
   19122 (Prnp)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mmu00537]
 Others
  19122 (Prnp)
SSDB
Motif
Pfam: Prion Prion_bPrPp
Other DBs
NCBI-GeneID: 19122
NCBI-ProteinID: NP_001265185
MGI: 97769
Ensembl: ENSMUSG00000079037
Vega: OTTMUSG00000014846
UniProt: P04925 Q4FJQ7
Structure
PDB: 

Position
2 F2; 2 64.07 cM
AA seq 254 aa
MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPH
GGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAV
VGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVN
ITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPP
VILLISFLIFLIVG
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcgaaccttggctactggctgctggccctctttgtgactatgtggactgatgtcggc
ctctgcaaaaagcggccaaagcctggagggtggaacaccggtggaagccggtatcccggg
cagggaagccctggaggcaaccgttacccacctcagggtggcacctgggggcagccccac
ggtggtggctggggacaaccccatgggggcagctggggacaacctcatggtggtagttgg
ggtcagccccatggcggtggatggggccaaggagggggtacccataatcagtggaacaag
cccagcaaaccaaaaaccaacctcaagcatgtggcaggggctgcggcagctggggcagta
gtggggggccttggtggctacatgctggggagcgccatgagcaggcccatgatccatttt
ggcaacgactgggaggaccgctactaccgtgaaaacatgtaccgctaccctaaccaagtg
tactacaggccagtggatcagtacagcaaccagaacaacttcgtgcacgactgcgtcaat
atcaccatcaagcagcacacggtcaccaccaccaccaagggggagaacttcaccgagacc
gatgtgaagatgatggagcgcgtggtggagcagatgtgcgtcacccagtaccagaaggag
tcccaggcctattacgacgggagaagatccagcagcaccgtgcttttctcctcccctcct
gtcatcctcctcatctccttcctcatcttcctgatcgtgggatga

DBGET integrated database retrieval system