KEGG   Mus musculus (mouse): 19124
Entry
19124             CDS       T01002                                 

Symbol
Procr, AI325044, Ccca, Ccd41, Epcr
Name
(RefSeq) protein C receptor, endothelial
  KO
K06557  protein C receptor, endothelial (EPCR)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    19124 (Procr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mmu04090]
    19124 (Procr)
CD molecules [BR:mmu04090]
 Proteins
  19124 (Procr)
SSDB
Motif
Pfam: MHC_I_3 MHC_I FANCI_S1-cap
Other DBs
NCBI-GeneID: 19124
NCBI-ProteinID: NP_035301
MGI: 104596
Ensembl: ENSMUSG00000027611
Vega: OTTMUSG00000016132
UniProt: Q64695
Position
2:155592159..155597398
AA seq 242 aa
MLTKFLPLLLLLLPGCALCNSDGSQSLHMLQISYFQDNHHVRHQGNASLGKLLTHTLEGP
SQNVTILQLQPWQDPESWERTESGLQIYLTQFESLVKLVYRERKENVFFPLTVSCSLGCE
LPEEEEEGSEPHVFFDVAVNGSAFVSFRPKTAVWVSGSQEPSKAANFTLKQLNAYNRTRY
ELQEFLQDTCVEFLENHITTQNMKGSQTGRSYTSLVLGILMGCFIIAGVAVGIFMCTSGR
RC
NT seq 729 nt   +upstreamnt  +downstreamnt
atgttgacgaagtttctgccgctactgctgctgctgctgcctggctgcgccctttgtaac
tccgatggctcccaaagcctgcatatgctccagatctcctatttccaagacaaccatcat
gtgaggcatcagggcaacgcctctctgggaaaactcctgacacacacgctggaaggcccc
agccaaaacgtcaccatcctccagctacagccctggcaggatccggagagctgggagcgc
acagagagtggcctgcagatctatctgacccagttcgaaagcctggtgaagctggtatat
cgcgagcgcaaggagaacgtgttctttcctctcactgttagctgctccctgggctgcgag
ctgccggaggaggaggaggagggctctgaaccccatgtcttcttcgatgtggccgtgaat
ggaagcgcttttgtaagtttccggccaaagactgccgtgtgggtgtcaggctcccaggag
ccctccaaagcagccaacttcaccctgaagcagctcaatgcctacaaccggactcggtat
gaactgcaggaatttcttcaggacacttgtgtggagttcctggagaaccacatcaccacg
caaaacatgaaagggagccaaacaggtcgctcttacacatcactggtcctgggcatcctg
atgggctgtttcataatcgctggtgtggccgtgggcatcttcatgtgcacaagtggacgg
cgttgctaa

DBGET integrated database retrieval system