KEGG   Mus musculus (mouse): 19141
Entry
19141             CDS       T01002                                 

Gene name
Lgmn, A, AEP, AI746452, AU022324, Pr, Prsc1
Definition
(RefSeq) legumain
  KO
K01369  legumain [EC:3.4.22.34]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
mmu04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    19141 (Lgmn)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    19141 (Lgmn)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19141 (Lgmn)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.34  legumain
     19141 (Lgmn)
Peptidases and inhibitors [BR:mmu01002]
 Cysteine peptidases
  Family C13: legumain family
   19141 (Lgmn)
SSDB
Motif
Pfam: Peptidase_C13
Other DBs
NCBI-GeneID: 19141
NCBI-ProteinID: NP_035305
MGI: 1330838
Ensembl: ENSMUSG00000021190
Vega: OTTMUSG00000023302
UniProt: O89017 A2RTI3 Q3UE99
Structure
PDB: 
4NOM 4NOK 4NOL 4NOJ

Position
12; 12 E
AA seq 435 aa
MTWRVAVLLSLVLGAGAVPVGVDDPEDGGKHWVVIVAGSNGWYNYRHQADACHAYQIIHR
NGIPDEQIIVMMYDDIANSEENPTPGVVINRPNGTDVYKGVLKDYTGEDVTPENFLAVLR
GDAEAVKGKGSGKVLKSGPRDHVFIYFTDHGATGILVFPNDDLHVKDLNKTIRYMYEHKM
YQKMVFYIEACESGSMMNHLPDDINVYATTAANPKESSYACYYDEERGTYLGDWYSVNWM
EDSDVEDLTKETLHKQYHLVKSHTNTSHVMQYGNKSISTMKVMQFQGMKHRASSPISLPP
VTHLDLTPSPDVPLTILKRKLLRTNDVKESQNLIGQIQQFLDARHVIEKSVHKIVSLLAG
FGETAERHLSERTMLTAHDCYQEAVTHFRTHCFNWHSVTYEHALRYLYVLANLCEAPYPI
DRIEMAMDKVCLSHY
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgacctggagagtggctgtgcttctcagcctggtgctgggtgctggtgccgttcccgtc
ggtgtggacgatcccgaggatggaggcaagcactgggtggtgattgtggcgggctccaat
ggctggtataattaccgacaccaggcagacgcatgccacgcctaccagatcatccaccgg
aacgggattcctgacgagcagatcatagtgatgatgtatgacgacattgccaactctgaa
gaaaaccctaccccaggtgttgtgatcaaccgacctaacggcacagatgtatacaaggga
gtcctgaaggactacaccggagaggatgtgactccagagaatttcctcgccgtgctgaga
ggtgacgcagaagctgtgaagggcaaagggtctggaaaagtcttgaagagtggcccccga
gatcatgtcttcatttacttcaccgaccacggagccaccgggatcctggtgtttcctaat
gatgatcttcatgtcaaggacctgaataagactattcgctacatgtatgaacacaaaatg
taccagaagatggtgttctacattgaagcttgtgagtctggctccatgatgaaccacctg
cccgacgacatcaacgtttatgcaactactgcggccaaccccaaggagtcatcttatgcc
tgctactacgacgaggagaggggcacttacctgggtgactggtacagcgtcaactggatg
gaagactccgatgtggaggacctgaccaaagagacccttcacaagcagtaccacctggtc
aagtcccacaccaacaccagccatgtcatgcaatatgggaacaaatctatctctaccatg
aaagtgatgcagtttcagggaatgaagcacagagccagttcccccatctccctgcctccg
gtcacacaccttgacctcacccccagccctgacgtgcccctgaccatcttgaagaggaag
ctgctgagaaccaacgacgtgaaggaatcccagaatctcattgggcagatccagcaattt
ctggatgccaggcacgtcattgagaagtctgtgcacaagatcgtttccctgctggcggga
tttggggaaactgctgagagacatctgtcagagaggaccatgctcacagcacatgactgc
taccaggaggctgtaacccacttccgcacacactgctttaactggcactctgtcacgtac
gagcatgccttgcggtacttgtatgtgctggccaatctctgtgaggcaccatatccgatt
gacaggatagagatggccatggacaaagtgtgtcttagtcactactga

DBGET integrated database retrieval system