KEGG   Mus musculus (mouse): 19152Help
Entry
19152             CDS       T01002                                 

Gene name
Prtn3, PR3, mPR3
Definition
(RefSeq) proteinase 3
  KO
K01350  myeloblastin [EC:3.4.21.76]
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19152 (Prtn3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.76  myeloblastin
     19152 (Prtn3)
Peptidases and inhibitors [BR:mmu01002]
 Serine peptidases
  Family S1: chymotrypsin family
   19152 (Prtn3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Trypsin_2
Motif
Other DBs
NCBI-GeneID: 19152
NCBI-ProteinID: NP_035308
MGI: 893580
Ensembl: ENSMUSG00000057729
Vega: OTTMUSG00000035169
UniProt: Q61096 A0A0R4IZY6
Position
10 C1; 10 39.72 cM
AA seq 254 aa AA seqDB search
MAGSYPSPKGIHPFLLLALVVGGAVQASKIVGGHEARPHSRPYVASLQLSRFPGSHFCGG
TLIHPRFVLTAAHCLQDISWQLVTVVLGAHDLLSSEPEQQKFTISQVFQNNYNPEENLND
VLLLQLNRTASLGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVV
TFLCREHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSM
YVDWIQNVLRGAEP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggctggaagctacccatcccccaaggggatccatcccttcctgctgcttgccctggtg
gttggtggcgcagtccaggcctccaagattgtaggtgggcacgaggctcggccccactct
cggccttatgtggcatccctgcagctgagcaggttccctgggagccacttctgtggtggc
accctgatccacccgagattcgtgctgacagccgcccactgcctgcaggacatctcctgg
cagcttgtgacagtggtgctgggtgcccacgacctgctgagctcggagcctgagcagcag
aagttcaccatcagtcaggtcttccagaacaattacaaccccgaggagaacctcaatgac
gtgcttctcctccagctaaaccggacagcctccctgggcaaggaggtggcggtggcttct
ctgccccagcaggaccagactctgtcccagggcacccagtgcctggccatgggctggggt
cgcctgggcacccaagcacccacgccccgtgtgctgcaggaactgaacgtcacggtggtc
accttcctatgccgggaacacaacgtgtgcacgctggtgccacggagggcagcaggcata
tgcttcggagactcgggcggccccttgatctgcaatggcattcttcatggagtggactcc
ttcgtgatccgcgaatgcgcctccctccagttccctgatttcttcgcccgggtgtccatg
tatgtggactggattcaaaacgtgctgcggggcgcagagccctga

DBGET integrated database retrieval system