KEGG   Mus musculus (mouse): 19156Help
Entry
19156             CDS       T01002                                 

Gene name
Psap, AI037048, SGP-1
Definition
(RefSeq) prosaposin
  KO
K12382  saposin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04142  Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    19156 (Psap)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19156 (Psap)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   19156 (Psap)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SapB_1 SapB_2 SapA
Motif
Other DBs
NCBI-GeneID: 19156
NCBI-ProteinID: NP_035309
MGI: 97783
Ensembl: ENSMUSG00000004207
Vega: OTTMUSG00000016474
UniProt: Q61207 Q3UFE8
Structure
PDB: 

Position
10 B4; 10 30.02 cM
AA seq 557 aa AA seqDB search
MYALALFASLLATALTSPVQDPKTCSGGSAVLCRDVKTAVDCGAVKHCQQMVWSKPTAKS
LPCDICKTVVTEAGNLLKDNATQEEILHYLEKTCEWIHDSSLSASCKEVVDSYLPVILDM
IKGEMSNPGEVCSALNLCQSLQEYLAEQNQKQLESNKIPEVDMARVVAPFMSNIPLLLYP
QDHPRSQPQPKANEDVCQDCMKLVSDVQTAVKTNSSFIQGFVDHVKEDCDRLGPGVSDIC
KNYVDQYSEVCVQMLMHMQDQQPKEICVLAGFCNEVKRVPMKTLVPATETIKNILPALEM
MDPYEQNLVQAHNVILCQTCQFVMNKFSELIVNNATEELLVKGLSNACALLPDPARTKCQ
EVVGTFGPSLLDIFIHEVNPSSLCGVIGLCAARPELVEALEQPAPAIVSALLKEPTPPKQ
PAQPKQSALPAHVPPQKNGGFCEVCKKLVLYLEHNLEKNSTKEEILAALEKGCSFLPDPY
QKQCDDFVAEYEPLLLEILVEVMDPGFVCSKIGVCPSAYKLLLGTEKCVWGPSYWCQNME
TAARCNAVDHCKRHVWN
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgtacgccctcgccctcttcgccagccttctggccaccgctctgaccagccctgtccaa
gacccgaagacatgctctgggggctcagcagtgctgtgcagagatgtgaagacggcggtg
gactgtggggccgtgaagcactgccagcagatggtctggagcaagcccacagcgaaatcc
cttccttgcgacatatgcaaaactgttgtcaccgaagctgggaacttgctgaaagataat
gctacgcaggaggagatccttcattacctggagaagacctgtgagtggattcatgactcc
agcctgtcggcctcgtgcaaggaggtggttgactcttacctgcctgtcatcctggacatg
attaagggcgagatgagcaaccctggggaagtgtgctctgcgctcaacctctgccagtcc
cttcaggagtacttggccgagcaaaaccagaaacagcttgagtccaacaagatcccggag
gtggacatggcccgtgtggttgcccccttcatgtccaacatccctctcctgctgtaccct
caggatcacccccgcagccagccccaacctaaggctaacgaggacgtctgccaggactgt
atgaagctggtgtctgatgtccagactgctgtgaagaccaactccagctttatccagggc
ttcgtggaccacgtgaaggaggattgtgaccgcttggggccaggcgtgtctgacatatgc
aagaactacgtggaccagtattccgaggtctgtgtccagatgttgatgcacatgcaggat
cagcaacccaaggaaatctgtgtgctggctggcttctgtaatgaggtcaagagagtgcca
atgaagactctggtccctgccaccgagaccattaagaacatcctccctgccctggagatg
atggacccctatgagcagaatctggtccaggcccacaatgtgattttatgccagacctgt
cagtttgtgatgaataagttttctgagctgattgtcaataatgccactgaggagctccta
gttaaaggtttgagcaacgcatgcgcactgctccccgatcctgccagaaccaagtgccag
gaggtggtgggaacatttggcccctccctgttggacatctttatccatgaggtaaacccc
agctctctgtgcggtgtgatcggcctctgtgctgcccgcccggagttggtggaggcactt
gagcagcctgcgccagccattgtatctgcactgctcaaagagcccacaccgccaaagcag
cccgcacagcccaagcagtcggcattgcccgcccatgtgcctcctcagaagaatggtggg
ttctgtgaggtgtgcaagaaactggtcctctatttggaacataacctggagaaaaacagc
accaaggaggaaatcctggccgcacttgagaagggctgcagcttcctgccagacccttac
cagaagcagtgcgatgactttgtggctgagtatgagcccttgctattggagatcctcgtg
gaagtgatggatcctggatttgtgtgctcgaaaattggagtttgcccttctgcctataag
ctgctgctgggaaccgagaagtgtgtctggggccctagctactggtgtcagaacatggag
actgccgcccgatgcaatgctgtcgatcattgcaaacgccatgtgtggaactag

DBGET integrated database retrieval system