KEGG   Mus musculus (mouse): 19157Help
Entry
19157             CDS       T01002                                 

Gene name
Cyth1, CLM1, CTH-1, CYTIP, Pscd1
Definition
(RefSeq) cytohesin 1
  KO
K18441  cytohesin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    19157 (Cyth1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    19157 (Cyth1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19157 (Cyth1)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    19157 (Cyth1)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    19157 (Cyth1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_8 BBS2_C PH_3 GPS2_interact FapA CEP170_C APG6_N Pilosulin DUF812 PH_16 Spc7 Phage_lysozyme
Motif
Other DBs
NCBI-GeneID: 19157
NCBI-ProteinID: NP_035310
MGI: 1334257
Ensembl: ENSMUSG00000017132
Vega: OTTMUSG00000003880
UniProt: Q9QX11 Q570Y7
Position
11; 11 E2
AA seq 398 aa AA seqDB search
MEDDDSYVPSDLTAEERQELENIRRRKQELLADIQRLKEEIAEVANEIESLGSTEERKNM
QRNKQVAMGRKKFNMDPKKGIQFLIENGLLKNTCEDIAQFLYKGEGLNKTAIGDYLGERD
EFSIQVLHAFVELHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCQCNTGVF
QSTDTCYVLSFAIIMLNTSLHNPNVKDKPTVERFIAMNRGINDGGDLPEELLRNLYESIK
NEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKE
PRGIIPLENLSIREVEDSKKPNCFELYIPDNKDQVIKACKTEADGRVVEGNHTVYRISAP
TPEEKEDWIKCIKAAISRDPFYEMLAARKKKVSSTKRH
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggaggacgatgacagctatgtccccagtgacctgactgcagaagagcgtcaagaactg
gagaacatccggcggaggaagcaggagctgctggctgacatccagaggctaaaggaagag
atagcagaagttgctaatgaaattgaaagcctgggatccacagaggaaaggaaaaacatg
cagaggaacaaacaggtagccatgggcagaaagaaatttaacatggatcctaaaaagggg
atccagttcttaatcgagaatggcctgctgaagaacacttgtgaggacatcgcccagttc
ctgtataaaggggaggggctcaacaagacagccatcggcgactaccttggggagagggat
gagttcagcatccaggtcctgcatgcgtttgtggaactgcacgagttcaccgacctgaac
ctcgtccaggccttgcggcagttcctgtggagcttccggctccctggagaggcccagaag
attgaccggatgatggaggcctttgcccagcggtactgtcagtgcaatactggggtgttc
cagtctacagacacctgctatgtcctgtccttcgcaatcataatgctgaacaccagccta
cacaaccccaatgtcaaagacaagcctacggtggagagattcatcgccatgaaccgaggc
atcaacgacggaggagacctgccggaggagctgctccggaatctctatgagagcatcaaa
aacgagccctttaaaatccccgaagatgatgggaatgacctcacacacactttcttcaat
ccagaccgagagggctggctgctcaagctcggaggtggcagggtaaagacctggaagagg
cgctggttcattctgactgacaactgcctttactactttgaatacaccacggacaaagag
ccccgcgggattatccccctggagaacctgagtatccgagaagtggaggactccaaaaag
ccgaactgctttgagctttatatccctgacaataaagaccaggtgattaaggcctgtaag
acagaggcggacgggcgagtggtggaagggaaccacactgtgtaccgcatctcagcccca
actccggaagagaaggaagactggatcaaatgcatcaaggctgccatcagcagagaccct
ttctacgagatgcttgcagcacggaaaaagaaggtctcctccacaaagagacactga

DBGET integrated database retrieval system