KEGG   Mus musculus (house mouse): 19158
Entry
19158             CDS       T01002                                 
Symbol
Cyth2, ARNO, CLM2, Pscd2
Name
(RefSeq) cytohesin 2
  KO
K18441  cytohesin
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
mmu05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    19158 (Cyth2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    19158 (Cyth2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    19158 (Cyth2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19158 (Cyth2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    19158 (Cyth2)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    19158 (Cyth2)
SSDB
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3 PH_20 FlgN NUDE_C
Other DBs
NCBI-GeneID: 19158
NCBI-ProteinID: NP_035311
MGI: 1334255
Ensembl: ENSMUSG00000003269
UniProt: P63034
Structure
Position
7:complement(45456058..45463857)
AA seq 400 aa
MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQ
RNRKMAMGRKKFNMDPKKGIQFLVEHELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREE
LNLSVLHAFVDLHEFTDLNLVQALRQFLWSFRLPGEAQKIDRMMEAFAQRYCLCNPGVFQ
STDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGDLPEDLLRNLYDSIRN
EPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
RGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPT
QEEKDEWIKSIQAAVSVDPFYEMLAARKKRISVKKKQEQP
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggaggacggtgtctacgagcccccagacttgactccagaggagcgcatggagttggag
aacatccggcggcgcaagcaggagctgctggtggagatccagcgcctgcgagaagagcta
agtgaagctatgagcgaggtggagggtctggaggccaatgagggcagtaagaccttgcag
cggaaccggaagatggcaatgggcaggaagaaattcaacatggaccccaaaaaggggatc
caattcttggtggagcatgaacttctgcagaacacgcctgaggaaattgcccgcttcctg
tacaagggcgaggggctgaacaagacagccattggggactacctaggggaaagggaagag
ctgaacctgtctgtgctccatgcttttgtggatctccatgagttcaccgacctcaacctg
gtgcaggccctccggcaattcctatggagctttcgcctccctggagaggctcagaaaatt
gatcgaatgatggaggcctttgcccagagatactgcttatgcaaccctggggtcttccag
tctacagacacctgctacgtgttgtcctttgccgtgatcatgctgaacaccagccttcac
aatcccaatgtcagggacaagccgggcctggagcgctttgtggccatgaaccggggcatc
aacgagggtggggatctgcctgaggatcttctcaggaacctctacgacagcatccggaac
gagcccttcaaaatcccagaggatgatgggaatgatctcacccacaccttcttcaaccca
gaccgagagggctggctcctaaagctgggagggggccgggtgaagacttggaagcggcgc
tggttcatccttacagacaactgcctctactactttgaatacactacggacaaggagccc
cgagggattatccccctagagaacctgagcatccgggaggtggacgatcctcggaagccg
aactgctttgagctttacattcccaacaataagggacagctcatcaaagcctgcaaaaca
gaggctgacggccgggtagtggaggggaaccacatggtgtaccgaatctcagcacccacc
caggaggagaaagatgagtggatcaaatccatccaggctgctgtaagtgtggaccccttc
tatgagatgttggcagcaagaaagaagcgaatttctgtgaagaagaagcaagaacaaccc
tga

DBGET integrated database retrieval system