KEGG   Mus musculus (mouse): 19159Help
Entry
19159             CDS       T01002                                 

Gene name
Cyth3, AI648983, ARNO3, CLM3, Grp1, Pscd3
Definition
(RefSeq) cytohesin 3
  KO
K18441  cytohesin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04072  Phospholipase D signaling pathway
mmu04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    19159 (Cyth3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    19159 (Cyth3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19159 (Cyth3)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Arf GTPases and associated proteins
   Arf associated proteins
    19159 (Cyth3)
 Endosome - Golgi transport
   Arf GTPase associated proteins
    19159 (Cyth3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec7 PH PH_11 PH_8 PH_3 SASRP1 GPS2_interact
Motif
Other DBs
NCBI-GeneID: 19159
NCBI-ProteinID: NP_035312
MGI: 1335107
Ensembl: ENSMUSG00000018001
Vega: OTTMUSG00000023404
UniProt: O08967 Q3TXK1
Structure
PDB: 

Position
5 G2; 5 82.36 cM
AA seq 399 aa AA seqDB search
MDEGGGGEGGSVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEE
SKTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYL
GERDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCN
PGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLY
ESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTT
DKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRI
SAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaggcggtggcggtgagggcggcagcgtgcctgaagacctgtcattagaagag
cgagaagaacttttggacattcgtagaagaaaaaaggaacttattgatgacattgagagg
ctgaaatatgaaattgcagaagtgatgacggagattgacaacctgacttcagtggaggag
agcaaaactactcagaggaacaagcaaatagccatgggaaggaagaaattcaacatggac
cccaaaaagggcattcagttcctaattgagaacgacctgctgcagagctccccagaggat
gtcgcccagtttctgtacaaaggagagggcctgaacaagaccgtcatcggagactacctg
ggtgagagggatgactttaatatcaaagttcttcaggcttttgttgagctgcatgagttt
gctgatctcaaccttgtccaggccttaaggcagttcctatggagcttcagacttcctgga
gaggcacagaagatcgaccgcatgatggaggcctttgcatcccgatactgcctgtgcaac
cctggggtcttccagtccacagatacatgctacgtgctctcctttgccatcatcatgctc
aacaccagcttgcacaaccacaacgtgcgcgacaagcccaccgctgagcgcttcatcacc
atgaaccgaggcatcaacgagggtggggaccttcctgaggagctgctgaggaacttgtat
gaaagtatcaagaatgagccgtttaagatcccagaagacgacggaaatgacctgacacac
acgttcttcaacccagaccgagaaggctggctgctgaagctggggggtcgtgtgaagacc
tggaaacggcgctggttcatcctcacagataactgcctctactactttgagtacaccacg
gacaaggagcccaggggcatcatccccctggagaacctcagcatcagggaggtggaggac
ccccggaagccgaactgctttgagctgtataaccccagtcacaaaggtcaagtcatcaag
gcctgcaagacggaggccgatggccgtgtggtggagggcaaccacgttgtgtaccggatc
tctgcccccagcccggaggaaaaggaggagtggatgaagtccatcaaagcaagcatcagt
agggacccgttctatgacatgttggccacgaggaaaaggaggattgccaataagaaatag

DBGET integrated database retrieval system