KEGG   Mus musculus (mouse): 19164
Entry
19164             CDS       T01002                                 

Gene name
Psen1, Ad3, Ad3h, P, PS, PS-1, PS1, S18, S182
Definition
(RefSeq) presenilin 1
  KO
K04505  presenilin 1 [EC:3.4.23.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04310  Wnt signaling pathway
mmu04330  Notch signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
mmu05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    19164 (Psen1)
   04330 Notch signaling pathway
    19164 (Psen1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    19164 (Psen1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    19164 (Psen1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19164 (Psen1)
   05022 Pathways of neurodegeneration - multiple diseases
    19164 (Psen1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19164 (Psen1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     19164 (Psen1)
Peptidases and inhibitors [BR:mmu01002]
 Aspartic peptidases
  Family A22: presenilin family
   19164 (Psen1)
SSDB
Motif
Pfam: Presenilin LAP1C LRRC37AB_C
Other DBs
NCBI-GeneID: 19164
NCBI-ProteinID: NP_001349200
MGI: 1202717
Ensembl: ENSMUSG00000019969
Position
12 D1; 12 38.84 cM
AA seq 467 aa
MTEIPAPLSYFQNAQMSEDSHSSSAIRSQNDSQERQQQHDRQRLDNPEPISNGRPQSNSR
QVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTE
DTETVGQRALHSILNAAIMISVIVIMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFI
YLGEVFKTYNVAVDYVTVALLIWNFGVVGMIAIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAE
GDPEAQRRVPKNPKYNTQRAERETQDSGSGNDDGGFSEEWEAQRDSHLGPHRSTPESRAA
VQELSGSILTSEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCL
TLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgacagagatacctgcacctttgtcctacttccagaatgcccagatgtctgaggacagc
cactccagcagcgccatccggagccagaatgacagccaagaacggcagcagcagcatgac
aggcagagacttgacaaccctgagccaatatctaatgggcggccccagagtaactcaaga
caggtggtggaacaagatgaggaggaagacgaagagctgacattgaaatatggagccaag
catgtcatcatgctctttgtccccgtgaccctctgcatggtcgtcgtcgtggccaccatc
aaatcagtcagcttctatacccggaaggacggtcagctaatctacaccccattcacagaa
gacactgagactgtaggccaaagagccctgcactcgatcctgaatgcggccatcatgatc
agtgtcattgtcattatgaccatcctcctggtggtcctgtataaatacaggtgctacaag
gtcatccacgcctggcttattatttcatctctgttgttgctgttctttttttcgttcatt
tacttaggggaagtatttaagacctacaatgtcgccgtggactacgttacagtagcactc
ctaatctggaattttggtgtggtcgggatgattgccatccactggaaaggcccccttcga
ctgcagcaggcgtatctcattatgatcagtgccctcatggccctggtatttatcaagtac
ctccccgaatggaccgcatggctcatcttggctgtgatttcagtatatgatttggtggct
gttttatgtcccaaaggcccacttcgtatgctggttgaaacagctcaggaaagaaatgag
actctctttccagctcttatctattcctcaacaatggtgtggttggtgaatatggctgaa
ggagacccagaagcccaaaggagggtacccaagaaccccaagtataacacacaaagagcg
gagagagagacacaggacagtggttctgggaacgatgatggtggcttcagtgaggagtgg
gaggcccaaagagacagtcacctggggcctcatcgctccactcccgagtcaagagctgct
gtccaggaactttctgggagcattctaacgagtgaagacccggaggaaagaggagtaaaa
cttggactgggagatttcattttctacagtgttctggttggtaaggcctcagcaaccgcc
agtggagactggaacacaaccatagcctgctttgtagccatactgatcggcctgtgcctt
acattactcctgctcgccattttcaagaaagcgttgccagccctccccatctccatcacc
ttcgggctcgtgttctacttcgccacggattaccttgtgcagcccttcatggaccaactt
gcattccatcagttttatatctag

KEGG   Mus musculus (mouse): 19165
Entry
19165             CDS       T01002                                 

Gene name
Psen2, ALG, ALG-3, Ad4, Ad4h, Alg3, P, PS, PS-2, PS2, Psnl2, STM2
Definition
(RefSeq) presenilin 2
  KO
K04522  presenilin 2 [EC:3.4.23.-]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu04722  Neurotrophin signaling pathway
mmu05010  Alzheimer disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    19165 (Psen2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    19165 (Psen2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19165 (Psen2)
   05022 Pathways of neurodegeneration - multiple diseases
    19165 (Psen2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19165 (Psen2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     19165 (Psen2)
Peptidases and inhibitors [BR:mmu01002]
 Aspartic peptidases
  Family A22: presenilin family
   19165 (Psen2)
SSDB
Motif
Pfam: Presenilin
Other DBs
NCBI-GeneID: 19165
NCBI-ProteinID: NP_001122077
MGI: 109284
Ensembl: ENSMUSG00000010609
Vega: OTTMUSG00000021488
UniProt: Q61144 Q3U4P5
Position
1 H4; 1 84.19 cM
AA seq 448 aa
MLAFMASDSEEEVCDERTSLMSAESPTSRSCQEGRPGPEDGESTAQWRTQESEEDCEEDP
DRYACSGAPGRPSGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLI
YTPFTEDTPSVGQRLLNSVLNTLIMISVIVVMTIFLVVLYKYRCYKFIHGWLIMSSLMLL
FLFTYIYLGEVLKTYNVAMDYPTLFLAVWNFGAVGMVCIHWKGPLVLQQAYLIVISALMA
LVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVW
TVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEAFEAPLPGYPGEELEEEEERGV
KLGLGDFIFYSVLVGKAAATGNGDWNTTLACFIAILIGLCLTLLLLAVFKKALPALPISI
TFGLIFYFSTDNLVRPFMDTLASHQLYI
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgctcgcattcatggcctctgacagcgaggaagaggtgtgtgatgagcggacgtccttg
atgtcagccgagagccccacatctcgctcctgccaggaaggcaggccaggcccggaggat
ggagagagcactgcccagtggaggactcaggagagcgaagaagactgtgaagaggacccg
gaccgctacgcatgcagtggggctcctgggcgaccgtcgggcctggaggaagagctgacc
ctcaagtatggggcgaagcatgtgatcatgctattcgtgcctgtcacgctgtgtatgatc
gtggtggtggccactatcaagtctgtgcgtttctacactgagaagaacgggcagctcatc
tacacgcccttcacggaggacacgccctcggtgggccagcggctcctcaactccgtgctt
aacaccctcatcatgatcagcgtcatcgtagtcatgaccatcttcctcgtggtactctac
aagtatcgatgctacaagttcatccatggctggctgatcatgtcctccctgatgctcctc
ttcttgttcacctacatctacctcggggaagtgctcaagacctacaatgtggccatggac
tatcccacactcttcctggctgtctggaacttcggggcagtgggcatggtgtgcatccac
tggaaggggcctctggtgctgcagcaggcttaccttattgtgatcagcgcactcatggcc
ctggtgttcatcaagtacctgccggagtggtctgcctgggtcatcttgggtgccatctct
gtgtacgatctcgtggccgtgctgtgccccaaagggccactgaggatgctggtggaaact
gcccaggagagaaatgagcccatatttcctgccctgatatactcatctgccatggtgtgg
acggtgggcatggcaaagctggacccctcctctcaaggagcgctgcagctcccctatgac
ccagagatggaagaagactcctacgacagttttggagaaccctcataccctgaagccttc
gaagcccccctgcctggctacccaggggaggagctggaggaggaggaggaaaggggcgtg
aagctcggcctgggagacttcatcttctacagcgtcctggtgggcaaggctgcagccact
ggcaacggagactggaacactacgctggcctgttttatcgccatcctcattggcttgtgt
ctcaccctcctgctgcttgctgtgttcaagaaggctctgcccgccctccccatctccatc
acctttggactcatcttctacttctccacagacaacctggtgcgccctttcatggacact
ctggcctcccaccagctctacatctga

DBGET integrated database retrieval system