KEGG   Mus musculus (mouse): 19166
Entry
19166             CDS       T01002                                 

Gene name
Psma2, Lmp, Lmpc3
Definition
(RefSeq) proteasome subunit alpha 2
  KO
K02726  20S proteasome subunit alpha 2 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19166 (Psma2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19166 (Psma2)
   05012 Parkinson disease
    19166 (Psma2)
   05014 Amyotrophic lateral sclerosis
    19166 (Psma2)
   05016 Huntington disease
    19166 (Psma2)
   05017 Spinocerebellar ataxia
    19166 (Psma2)
   05020 Prion disease
    19166 (Psma2)
   05022 Pathways of neurodegeneration - multiple diseases
    19166 (Psma2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19166 (Psma2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19166 (Psma2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19166 (Psma2)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   19166 (Psma2)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    19166 (Psma2)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 19166
NCBI-ProteinID: NP_032970
MGI: 104885
Ensembl: ENSMUSG00000015671
UniProt: P49722
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
13; 13 A1
AA seq 234 aa
MAERGYSFSLTTFSPSGKLVQIEYALAAVAGGAPSVGIKAANGVVLATEKKQKSILYDER
SVHKVEPITKHIGLVYSGMGPDYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YTQSGGVRPFGVSLLICGWNEGRPYLFQSDPSGAYFAWKATAMGKNYVNGKTFLEKRYNE
DLELEDAIHTAILTLKESFEGQMTEDNIEVGICNEAGFRRLTPTEVRDYLAAIA
NT seq 705 nt   +upstreamnt  +downstreamnt
atggcagagcgcggttacagcttctcgctgactacattcagcccatctggtaagcttgtc
cagattgaatatgccttggctgcggtagctggaggggccccgtcagtggggattaaagct
gcaaatggcgtagtattagcaaccgagaaaaagcagaaatccatcctgtatgatgaaagg
agtgttcacaaggtggagcccattaccaagcacatcggtttggtgtacagtggcatgggc
cccgattacagagtacttgtacacagagctcggaaacttgctcagcaatactaccttgtt
taccaagaacccattcccacagcccagctggtacagagagtagcctctgtgatgcaggag
tacacgcagtcaggtggtgttcgtccatttggtgtttctttactcatttgtgggtggaat
gagggacgaccatatttatttcagtcagatccatctggagcttactttgcctggaaggcc
acagcaatgggaaagaactatgtgaacgggaaaactttccttgagaaaagatataatgaa
gacctagaactggaggatgccattcatacagccatcttaaccctaaaggaaagctttgaa
gggcagatgacagaagataacatagaagttgggatctgcaatgaggctggctttaggagg
ctcactccaactgaagtgagggattacctggctgccatagcgtga

KEGG   Mus musculus (mouse): 19167
Entry
19167             CDS       T01002                                 

Gene name
Psma3, Lmp, Lmpc8
Definition
(RefSeq) proteasome subunit alpha 3
  KO
K02727  20S proteasome subunit alpha 7 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19167 (Psma3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19167 (Psma3)
   05012 Parkinson disease
    19167 (Psma3)
   05014 Amyotrophic lateral sclerosis
    19167 (Psma3)
   05016 Huntington disease
    19167 (Psma3)
   05017 Spinocerebellar ataxia
    19167 (Psma3)
   05020 Prion disease
    19167 (Psma3)
   05022 Pathways of neurodegeneration - multiple diseases
    19167 (Psma3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19167 (Psma3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19167 (Psma3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19167 (Psma3)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   19167 (Psma3)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    19167 (Psma3)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 19167
NCBI-ProteinID: NP_035314
MGI: 104883
Ensembl: ENSMUSG00000060073
Vega: OTTMUSG00000035110
UniProt: O70435 Q58EV4
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
12; 12 C2
AA seq 255 aa
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSANDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagctccatcggcactgggtatgacttgtcagcctctacgttctctcctgatggaaga
gttttccaagttgaatatgccatgaaggctgtggaaaacagtagtacagctattgggatc
agatgtaaagatggtgttgtgtttggggtagaaaaactagtcctttctaaactttatgaa
gaaggctccaataaacgtctttttaatgttgatcgacatgttggaatggcagttgcaggt
ttgctggcagatgctcgttcattagcagacatagcgagagaagaagcatccaactttagg
tccaacttcggctataacattcctctaaaacatcttgcagacagagtggccatgtatgta
cacgcctatacactctacagcgctgttagaccttttggctgcagtttcatgttggggtct
tacagtgcgaatgatggtgcacagctctatatgatcgacccatcaggtgtttcatatggt
tactggggctgtgcgattggcaaagccaggcaggctgcaaagacagagatagaaaagctt
cagatgaaggaaatgacttgccgtgatgtagttaaagaagttgcaaaaataatttacata
gtacacgatgaagttaaggataaagcttttgaactggagctcagctgggttggtgaatta
actaaaggaagacatgaaattgttcccaaagacataagagaggaagcagagaaatatgcc
aaggaatctttgaaggaagaagatgaatcagatgatgacaatatgtaa

KEGG   Mus musculus (mouse): 19170
Entry
19170             CDS       T01002                                 

Gene name
Psmb1, AA409053, C81484, Lmp, Lmpc5
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 1
  KO
K02732  20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19170 (Psmb1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19170 (Psmb1)
   05012 Parkinson disease
    19170 (Psmb1)
   05014 Amyotrophic lateral sclerosis
    19170 (Psmb1)
   05016 Huntington disease
    19170 (Psmb1)
   05017 Spinocerebellar ataxia
    19170 (Psmb1)
   05020 Prion disease
    19170 (Psmb1)
   05022 Pathways of neurodegeneration - multiple diseases
    19170 (Psmb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19170 (Psmb1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19170 (Psmb1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19170 (Psmb1)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   19170 (Psmb1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    19170 (Psmb1)
SSDB
Motif
Pfam: Proteasome Cytochrom_C1
Other DBs
NCBI-GeneID: 19170
NCBI-ProteinID: NP_035315
MGI: 104884
Ensembl: ENSMUSG00000014769
UniProt: O09061 Q6RI64
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
17 A2; 17 8.95 cM
AA seq 240 aa
MLSTAAYRDVERELGMGPHGSAGPVQLRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGF
SIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLS
TILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQV
GFKNMQNVEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD
NT seq 723 nt   +upstreamnt  +downstreamnt
atgctttccactgctgcttaccgagacgtggaacgagagctgggaatggggcctcacggc
tccgccggccctgtgcagctgcggttttcgccttatgccttcaacggaggtactgtattg
gcaattgctggagaagatttttccatcgtcgcttcagacactcgattgagtgaaggattt
tcaattcatacccgagatagccccaaatgctacaaactgacagacaagacagtaattggc
tgcagtggtttccatggagattgtctcactttgacaaagattattgaagcaagattaaag
atgtacaagcattccaataacaaggccatgacaacgggggcgattgctgcaatgctgtct
accatcctgtactcacggcgcttcttcccttactatgtttacaacatcattggaggactt
gatgaagaaggaaagggagctgtgtacagctttgacccagtgggctcttaccagagagac
tctttcaaggcgggaggctcagcaagtgccatgctgcagcctctgctcgacaaccaggtt
ggcttcaaaaatatgcagaatgtagagcacgtccccctgacgctggacagagccatgagg
ctggtgaaagatgtcttcatttctgcagccgagagggatgtgtatactggagatgctctc
aggatctgcatcgtgaccaaagagggcatcagggaggaaactgttcccctgcggaaagac
tga

KEGG   Mus musculus (mouse): 19172
Entry
19172             CDS       T01002                                 

Gene name
Psmb4, Pro, Pros-27
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 4
  KO
K02736  20S proteasome subunit beta 7 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19172 (Psmb4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19172 (Psmb4)
   05012 Parkinson disease
    19172 (Psmb4)
   05014 Amyotrophic lateral sclerosis
    19172 (Psmb4)
   05016 Huntington disease
    19172 (Psmb4)
   05017 Spinocerebellar ataxia
    19172 (Psmb4)
   05020 Prion disease
    19172 (Psmb4)
   05022 Pathways of neurodegeneration - multiple diseases
    19172 (Psmb4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19172 (Psmb4)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19172 (Psmb4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19172 (Psmb4)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   19172 (Psmb4)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    19172 (Psmb4)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 19172
NCBI-ProteinID: NP_032971
MGI: 1098257
Ensembl: ENSMUSG00000005779
Vega: OTTMUSG00000019673
UniProt: P99026
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
3 F2.1; 3 40.74 cM
AA seq 264 aa
MEAFWESRAGHWAGGPAPGQFYRIPATPSGLMDPASAPCEGPITRTQNPMVTGTSVLGVK
FDGGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLKQVLGQMVIDEE
LLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAP
SLATGYGAYLAQPLLREVLEKQPVLSQTEARELVERCMRVLYYRDARSYNRFQIATVTEK
GVEIEGPLSAQTNWDIAHMISGFE
NT seq 795 nt   +upstreamnt  +downstreamnt
atggaagcgttttgggagtcacgggctggccactgggccgggggtccggctccagggcag
ttttaccgcatcccggccacccccagcggcctcatggacccggcgtcggcgccctgcgag
ggtcccatcactcggacccagaaccccatggtgaccgggacatcggtactcggggtgaag
ttcgacggcggagtggtgattgctgcagacatgctgggctcctacggctccctggctcgt
ttccgcaatatctctcgtattatgcgagtcaacgacagcactatgctgggtgcctcggga
gactacgctgatttccagtatttgaaacaagttctcggccagatggtgattgatgaagag
ctgttgggagatggacacagctatagccctagagctattcattcatggttgacaagagcc
atgtacagccgccgctccaagatgaatcccctgtggaacaccatggtcattggaggctat
gctgacggagaaagcttcctcggttatgtggacatgcttggtgtagcttatgaagcccct
tcactggccactggttatggtgcatacttggctcagcctctgcttcgagaagttctagag
aagcagccagtgctgagtcagactgaggctcgggagcttgtggagcgctgcatgagagtg
ctgtactacagagatgcccgttcgtataaccggtttcaaattgccactgtgactgaaaag
ggtgtcgagatagaaggaccgctgtccgcacagaccaactgggacatcgctcacatgatc
agtggctttgaatga

KEGG   Mus musculus (mouse): 19173
Entry
19173             CDS       T01002                                 

Gene name
Psmb5
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 5
  KO
K02737  20S proteasome subunit beta 5 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19173 (Psmb5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19173 (Psmb5)
   05012 Parkinson disease
    19173 (Psmb5)
   05014 Amyotrophic lateral sclerosis
    19173 (Psmb5)
   05016 Huntington disease
    19173 (Psmb5)
   05017 Spinocerebellar ataxia
    19173 (Psmb5)
   05020 Prion disease
    19173 (Psmb5)
   05022 Pathways of neurodegeneration - multiple diseases
    19173 (Psmb5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19173 (Psmb5)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19173 (Psmb5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19173 (Psmb5)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   19173 (Psmb5)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    19173 (Psmb5)
SSDB
Motif
Pfam: Proteasome DUF3991
Other DBs
NCBI-GeneID: 19173
NCBI-ProteinID: NP_035316
MGI: 1194513
Ensembl: ENSMUSG00000022193
UniProt: O55234
Structure
PDB: 
3UNB 3UNE

Position
14 C2; 14 27.86 cM
AA seq 264 aa
MALASVLQRPMPVNQHGFFGLGGGADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGT
TTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHDKYSSVSVP
NT seq 795 nt   +upstreamnt  +downstreamnt
atggcgctggctagcgtgttgcagcggccgatgccggtgaatcagcacgggttttttggg
ctcggaggtggtgcagatctgctggacttgggtccggggagtcctggtgatgggctgagc
ctagccgcgccgagctggggcgtcccggaggagccgcgaatcgaaatgcttcacggaacc
accaccctggccttcaagtttctccatggagtcattgttgcagcggattcccgggccaca
gcaggtgcttatattgcttcccagacggtgaagaaagtaatagagatcaacccgtacctt
ctgggcaccatggctgggggtgcagcggattgcagcttctgggagcggttgttggctcgg
cagtgtcgaatctatgagcttcgcaataaggaacgcatctcggtcgcagcagcctccaaa
ctgctcgctaacatggtgtatcagtacaaaggcatggggctgtctatgggcaccatgatc
tgtggctgggataagagaggccctggcctctactacgtagacagcgaggggaacaggatc
tctgggaccgccttctcagtgggctctggctccgtgtatgcttacggcgttatggatcga
ggctactcctatgacctgaaagtggaggaggcctatgatctggcccgccgagccatctac
caagccacctacagagatgcctactccggaggggcagtcaacctctaccacgtgcgggag
gatggctggatccgggtgtccagtgacaatgtagctgacttacatgacaagtacagtagt
gtatctgtcccctga

KEGG   Mus musculus (mouse): 19175
Entry
19175             CDS       T01002                                 

Gene name
Psmb6, Lmp, Lmp19, Mp, Mpnd
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 6
  KO
K02738  20S proteasome subunit beta 1 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19175 (Psmb6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19175 (Psmb6)
   05012 Parkinson disease
    19175 (Psmb6)
   05014 Amyotrophic lateral sclerosis
    19175 (Psmb6)
   05016 Huntington disease
    19175 (Psmb6)
   05017 Spinocerebellar ataxia
    19175 (Psmb6)
   05020 Prion disease
    19175 (Psmb6)
   05022 Pathways of neurodegeneration - multiple diseases
    19175 (Psmb6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19175 (Psmb6)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19175 (Psmb6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19175 (Psmb6)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   19175 (Psmb6)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    19175 (Psmb6)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 19175
NCBI-ProteinID: NP_032972
MGI: 104880
Ensembl: ENSMUSG00000018286
Vega: OTTMUSG00000006054
UniProt: Q60692
Structure
PDB: 
3UNB 3UNE

Position
11 B3; 11 42.99 cM
AA seq 238 aa
MAAALAVRRAGSAPAFGPEALTPDWENREVSTGTTIMAVQFNGGVVLGADSRTTTGSYIA
NRVTDKLTPIHDHIFCCRSGSAADTQAVADAVTYQLGFHSIELNEPPLVHTAASLFKEMC
YRYREDLMAGIIIAGWDPQEGGQVYSVPMGGMMVRQSFAIGGSGSSYIYGYVDATYREGM
TKDECLQFTANALALAMERDGSSGGVIRLAAIQESGVERQVLLGDQIPKFTIATLPPP
NT seq 717 nt   +upstreamnt  +downstreamnt
atggcggccgccttagctgttcgtcgagcggggtctgcaccggcctttgggccggaggct
ctcaccccagactgggaaaaccgggaagtctccacagggaccacgatcatggctgtgcag
tttaatgggggcgtggttctaggagcggactccaggacaaccactgggtcctacatcgcc
aatcgagtgactgacaagctgacccctatccacgatcacatcttctgctgccgctcaggc
tcagccgctgatacccaagcagtggcagacgctgtcacttaccagcttggtttccacagt
attgaactgaacgagcctccactagtccacacagccgccagtctctttaaggagatgtgt
taccggtacagagaagatctgatggcaggaatcatcattgcaggctgggaccctcaagaa
ggagggcaggtgtactctgttcccatggggggtatgatggtaagacagtcctttgccatc
ggaggctccgggagctcgtacatctatggctatgttgatgctacgtatcgggaaggcatg
accaaggacgaatgtctgcagttcactgccaatgctctcgctttggccatggaacgcgac
ggctccagtggaggggtgatccgcttggcagccattcaggagtcaggggtagagcggcag
gtgcttttgggagaccaaatccccaagttcaccattgccacgttgccacctccctga

KEGG   Mus musculus (mouse): 19177
Entry
19177             CDS       T01002                                 

Gene name
Psmb7, AU020723, DXMgi2, MC14
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 7
  KO
K02739  20S proteasome subunit beta 2 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19177 (Psmb7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19177 (Psmb7)
   05012 Parkinson disease
    19177 (Psmb7)
   05014 Amyotrophic lateral sclerosis
    19177 (Psmb7)
   05016 Huntington disease
    19177 (Psmb7)
   05017 Spinocerebellar ataxia
    19177 (Psmb7)
   05020 Prion disease
    19177 (Psmb7)
   05022 Pathways of neurodegeneration - multiple diseases
    19177 (Psmb7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19177 (Psmb7)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19177 (Psmb7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19177 (Psmb7)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   19177 (Psmb7)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    19177 (Psmb7)
SSDB
Motif
Pfam: Proteasome Pr_beta_C
Other DBs
NCBI-GeneID: 19177
NCBI-ProteinID: NP_035317
MGI: 107637
Ensembl: ENSMUSG00000026750
Vega: OTTMUSG00000012864
UniProt: P70195
Structure
PDB: 
3UNB 3UNE

Position
2 B; 2 24.42 cM
AA seq 277 aa
MAAVSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPFSVPNKKGT
RLGRYRCEKGTTAVLTEKVTPLEIEVLEETVQTMDTS
NT seq 834 nt   +upstreamnt  +downstreamnt
atggcggctgtgtcggtgtttcagccaccggtcggaggcttttcttttgataattgtcgc
aggaatgctgtcttggaagcggatttcgcaaaaaaggggttcaagctcccgaaagctcgg
aaaactggcactaccatcgcgggggtggtgtataaggatggcatagttcttggagcagac
acgagagcaactgaagggatggttgttgctgacaaaaactgttcaaaaattcacttcata
tctcctaatatttattgctgtggtgctgggacagctgcagacacagacatgacaacccag
cttatttcttccaacttggagctccactctctgaccactggccgcctcccgagagttgtt
acagctaatcggatgctgaagcagatgctcttcaggtatcaaggttacattggtgcagcc
ctagttttggggggagtagatgttactggacctcatctctacagcatctatcctcatgga
tcaactgataaattgccttatgtcaccatgggttctggctccttggcagcaatggctgtg
tttgaagataagtttaggccagatatggaggaggaagaagccaagaagctagtgagtgag
gctattgcagctggcatctttaatgacttggggtctggaagcaacattgatctgtgtgtt
atcagcaagagcaagctggactttcttcgtccattctcagtgcccaacaagaaagggacc
aggcttggccggtacagatgtgagaaaggcactaccgctgtcctcaccgagaaagttacc
cctctggagattgaggtgctagaagagactgttcagacaatggatacttcgtga

KEGG   Mus musculus (mouse): 26440
Entry
26440             CDS       T01002                                 

Gene name
Psma1, C2, HC2, Pro, Pros-30, alpha-type
Definition
(RefSeq) proteasome subunit alpha 1
  KO
K02725  20S proteasome subunit alpha 6 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    26440 (Psma1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26440 (Psma1)
   05012 Parkinson disease
    26440 (Psma1)
   05014 Amyotrophic lateral sclerosis
    26440 (Psma1)
   05016 Huntington disease
    26440 (Psma1)
   05017 Spinocerebellar ataxia
    26440 (Psma1)
   05020 Prion disease
    26440 (Psma1)
   05022 Pathways of neurodegeneration - multiple diseases
    26440 (Psma1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26440 (Psma1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    26440 (Psma1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    26440 (Psma1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     26440 (Psma1)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   26440 (Psma1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    26440 (Psma1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   26440 (Psma1)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 26440
NCBI-ProteinID: NP_036095
MGI: 1347005
Ensembl: ENSMUSG00000030751
Vega: OTTMUSG00000025343
UniProt: Q9R1P4 Q3TS44
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
7 F1; 7 59.32 cM
AA seq 263 aa
MFRNQYDNDVTVWSPQGRIHQIEYAMEAVKQGSATVGLKSKTHAVLVALKRAQSELAAHQ
KKILHVDNHIGISIAGLTADARLLCNFMRQECLDSRFVFDRPLPVSRLVSLIGSKTQIPT
QRYGRRPYGVGLLIAGYDDMGPHIFQTCPSANYFDCRAMSIGARSQSARTYLERHMSEFM
ECNLDELVKHGLRALRETLPAEQDLTTKNVSIGIVGKDLEFTIYDDDDVSPFLDGLEERP
QRKAQPSQAAEEPAEKADEPMEH
NT seq 792 nt   +upstreamnt  +downstreamnt
atgtttcgaaaccagtatgacaatgatgtcactgtttggagccctcagggcaggattcat
caaattgaatatgcaatggaagctgttaagcaaggttcagcaacagttggtctaaaatca
aaaacgcacgcagtgctggttgcactgaagagagcacagtcagagcttgccgctcaccag
aagaaaattctccatgttgacaaccatattggtatctcaattgcgggtctaactgctgat
gccagactgttatgcaactttatgcgccaggagtgtttggattccagatttgtgtttgac
agaccacttcctgtgtctcgtcttgtgtctctaattggaagcaaaacccagatcccaaca
cagcgatatggccggaggccgtatggtgttgggctgctcattgctggttatgatgatatg
ggccctcatattttccaaacctgtccatctgctaactattttgactgcagagctatgtct
attggagcccgttctcaatcagctcgtacttacctggagagacatatgtctgaatttatg
gagtgcaatttggatgaactggttaaacatggtctgcgtgccttaagagaaacactccct
gcagagcaggacctgaccacaaagaatgtttccattggaatcgttggtaaagacttggaa
tttacaatctacgatgatgatgatgtatctccattcctggatggtcttgaagaaagacca
cagagaaaagcacagccttcacaggctgctgaggaacctgcagaaaaagccgatgaacca
atggaacattaa

KEGG   Mus musculus (mouse): 26441
Entry
26441             CDS       T01002                                 

Gene name
Psma4, C9
Definition
(RefSeq) proteasome subunit alpha 4
  KO
K02728  20S proteasome subunit alpha 3 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    26441 (Psma4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26441 (Psma4)
   05012 Parkinson disease
    26441 (Psma4)
   05014 Amyotrophic lateral sclerosis
    26441 (Psma4)
   05016 Huntington disease
    26441 (Psma4)
   05017 Spinocerebellar ataxia
    26441 (Psma4)
   05020 Prion disease
    26441 (Psma4)
   05022 Pathways of neurodegeneration - multiple diseases
    26441 (Psma4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26441 (Psma4)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    26441 (Psma4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     26441 (Psma4)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   26441 (Psma4)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    26441 (Psma4)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N Phenol_monoox TRP_N
Other DBs
NCBI-GeneID: 26441
NCBI-ProteinID: NP_036096
MGI: 1347060
Ensembl: ENSMUSG00000032301
Vega: OTTMUSG00000036073
UniProt: Q9R1P0
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
9; 9 B
AA seq 261 aa
MSRRYDSRTTIFSPEGRLYQVEYAMEAIGHAGTCLGILANDGVLLAAERRNIHKLLDEVF
FSEKIYKLNEDMACSVAGITSDANVLTNELRLIAQRYLLQYQEPIPCEQLVTALCDIKQA
YTQFGGKRPFGVSLLYIGWDKHYGFQLYQSDPSGNYGGWKATCIGNNSAAAVSMLKQDYK
EGEMTLKSALALAVKVLNKTMDVSKLSAEKVEIATLTRESGKTVIRVLKQKEVEQLIKKH
EEEEAKAEREKKEKEQREKDK
NT seq 786 nt   +upstreamnt  +downstreamnt
atgtctcgaagatatgactccaggaccacaatattttctccagaaggtcgcttataccaa
gtggagtatgccatggaagccattggacatgcaggcacctgtttggggattttagccaat
gatggagttttgcttgcagcggagaggcgcaacatccacaagcttcttgatgaagtcttc
ttttctgagaaaatttataaacttaatgaggacatggcttgcagcgtggcaggcataaca
tctgatgctaacgttctgactaacgagctaaggctcattgctcaacggtacttattacag
tatcaggagccaattccctgtgagcagttggttacagcactgtgtgatatcaaacaggcg
tacacacagtttggaggcaaacgtccctttggtgtttctttgctgtatattggctgggat
aagcactatggctttcagctctatcagagtgacccaagtggaaactatgggggatggaaa
gccacatgcattgggaacaacagtgctgcggctgtgtcaatgttgaaacaagactacaaa
gaaggcgaaatgactctgaagtcagcgcttgctctggctgttaaggtgctaaataagaca
atggatgttagtaaactgtcagctgaaaaagtggaaatcgccacactaacaagagagagt
gggaagacggtgatcagagtcctcaagcaaaaggaagtggaacagttgatcaaaaaacat
gaagaggaagaagctaaggctgagcgggagaagaaagaaaaagaacagagagaaaaggat
aaatag

KEGG   Mus musculus (mouse): 26442
Entry
26442             CDS       T01002                                 

Gene name
Psma5, ZETA
Definition
(RefSeq) proteasome subunit alpha 5
  KO
K02729  20S proteasome subunit alpha 5 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    26442 (Psma5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26442 (Psma5)
   05012 Parkinson disease
    26442 (Psma5)
   05014 Amyotrophic lateral sclerosis
    26442 (Psma5)
   05016 Huntington disease
    26442 (Psma5)
   05017 Spinocerebellar ataxia
    26442 (Psma5)
   05020 Prion disease
    26442 (Psma5)
   05022 Pathways of neurodegeneration - multiple diseases
    26442 (Psma5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26442 (Psma5)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    26442 (Psma5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     26442 (Psma5)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   26442 (Psma5)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    26442 (Psma5)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 26442
NCBI-ProteinID: NP_036097
MGI: 1347009
Ensembl: ENSMUSG00000068749
Vega: OTTMUSG00000007299
UniProt: Q9Z2U1 Q3UPK6
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
3; 3 F3
AA seq 241 aa
MFLTRSEYDRGVNTFSPEGRLFQVEYAIEAIKLGSTAIGIQTSEGVCLAVEKRITSPLME
PSSIEKIVEIDAHIGCAMSGLIADAKTLIDKARVETQNHWFTYNETMTVESVTQAVSNLA
LQFGEEDADPGAMSRPFGVALLFGGVDEKGPQLFHMDPSGTFVQCDARAIGSASEGAQSS
LQEVYHKSMTLKEAIKSSLIILKQVMEEKLNATNIELATVQPGQNFHMFTKEELEEVIKD
I
NT seq 726 nt   +upstreamnt  +downstreamnt
atgttcctcactcggtccgagtacgacaggggtgtgaatactttttctcctgaaggaaga
ttatttcaagtggaatatgccattgaggctatcaagcttggttctacagccattggcatc
cagacctcagagggtgtatgtctagctgtggagaagagaattacctccccactaatggag
cctagcagcattgagaagattgtagagatcgatgctcatataggttgtgccatgagtggg
ctaattgctgatgctaaaactttaattgataaagccagagtggagacacagaaccactgg
ttcacctataatgagacaatgacagttgagagtgtgacccaggctgtgtccaatctggct
ctgcagtttggagaagaagatgcagatccaggtgctatgtctcgtccctttggagtagca
ttgttgtttggaggagttgatgagaaaggaccccaactgtttcacatggacccatctggg
acctttgtacagtgtgatgctcgagcaattggctctgcttctgagggtgcccagagctcc
ttgcaagaagtttaccataagtctatgactctgaaggaggccatcaagtcctcgctcatc
atcctcaagcaagtcatggaggagaagctgaatgcaaccaacatcgagctagccacggtg
cagcctggtcagaatttccacatgttcacaaaggaagaactggaggaggtgatcaaggac
atttaa

KEGG   Mus musculus (mouse): 26443
Entry
26443             CDS       T01002                                 

Gene name
Psma6, IOTA
Definition
(RefSeq) proteasome subunit alpha 6
  KO
K02730  20S proteasome subunit alpha 1 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    26443 (Psma6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26443 (Psma6)
   05012 Parkinson disease
    26443 (Psma6)
   05014 Amyotrophic lateral sclerosis
    26443 (Psma6)
   05016 Huntington disease
    26443 (Psma6)
   05017 Spinocerebellar ataxia
    26443 (Psma6)
   05020 Prion disease
    26443 (Psma6)
   05022 Pathways of neurodegeneration - multiple diseases
    26443 (Psma6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26443 (Psma6)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    26443 (Psma6)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     26443 (Psma6)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   26443 (Psma6)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    26443 (Psma6)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 26443
NCBI-ProteinID: NP_036098
MGI: 1347006
Ensembl: ENSMUSG00000021024
Vega: OTTMUSG00000034926
UniProt: Q9QUM9
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
12; 12 C1
AA seq 246 aa
MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL
LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD
ISQVYTQNAEMRPLGCCMILIGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLE
KKVKKKFDWTFEQTVETAITCLSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLV
ALAERD
NT seq 741 nt   +upstreamnt  +downstreamnt
atgtcccggggttccagcgccggttttgaccgtcacattactatcttctctcccgagggc
cgactctaccaagtagaatatgcttttaaggctattaaccagggtggacttacatctgtt
gctgtcagaggaaaggactgtgcagttattgtcacacagaagaaagtacccgacaaacta
ctggattccagcacagtgactcacttgttcaagataacggaaagcattggctgtgtgatg
acaggaatgacagctgacagcagatcccaggtacagagggcacgctatgaggcagctaat
tggaaatacaagtatggctatgaaattcctgtggacatgctgtgcaaaagaattgctgat
atttctcaagtctacacacagaacgctgaaatgaggccactcggttgttgtatgatttta
atcggtatcgatgaagagcaaggccctcaagtgtacaagtgtgatcctgcaggttactac
tgtggctttaaagccacggcggcaggagttaaacaaacagagtcaaccagcttccttgaa
aagaaagtgaagaagaaatttgattggacatttgaacagacagtggaaactgcaattaca
tgcctgtctactgttctgtcgattgacttcaaaccttcagaaatagaagttggagtagtt
acagttgaaaatcctaaattcaggattcttactgaagcagagattgacgctcaccttgtt
gctctagcagagagagactga

KEGG   Mus musculus (mouse): 26444
Entry
26444             CDS       T01002                                 

Gene name
Psma7, C6-, C6-I
Definition
(RefSeq) proteasome subunit alpha 7
  KO
K02731  20S proteasome subunit alpha 4 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    26444 (Psma7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26444 (Psma7)
   05012 Parkinson disease
    26444 (Psma7)
   05014 Amyotrophic lateral sclerosis
    26444 (Psma7)
   05016 Huntington disease
    26444 (Psma7)
   05017 Spinocerebellar ataxia
    26444 (Psma7)
   05020 Prion disease
    26444 (Psma7)
   05022 Pathways of neurodegeneration - multiple diseases
    26444 (Psma7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26444 (Psma7)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    26444 (Psma7)
   03051 Proteasome [BR:mmu03051]
    26444 (Psma7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     26444 (Psma7)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   26444 (Psma7)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    26444 (Psma7)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    26444 (Psma7)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 26444
NCBI-ProteinID: NP_036099
MGI: 1347070
Ensembl: ENSMUSG00000027566
Vega: OTTMUSG00000016235
UniProt: Q9Z2U0 Q542H2 Q3UIT9
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
2; 2 H4
AA seq 248 aa
MSYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGVRGKDIVVLGVEKKSVAKLQDERTVR
KICALDDNVCMAFAGLTADARIVINRARVECQSHRLTVEDPVTVEYITRYIASLKQRYTQ
SNGRRPFGISALIVGFDFDGTPRLYQTDPSGTYHAWKANAIGRGAKSVREFLEKNYTDDA
IETDDLTIKLVIKALLEVVQSGGKNIELAVMRRDQPLKILNPEEIEKYVAEIEKEKEENE
KKKQKKAS
NT seq 747 nt   +upstreamnt  +downstreamnt
atgagctacgaccgcgccatcaccgtcttctcgcccgacggccacctcttccaagtggag
tacgcgcaggaggcggtcaaaaagggctccaccgcggttggtgttcgaggaaaggacatt
gttgttcttggtgtggaaaaaaaatcagtggccaagctacaagatgaaagaacagtacga
aaaatctgcgccttggacgataacgtctgtatggcctttgcaggtctcaccgctgatgca
aggatagtcatcaacagagcccgggtagagtgccagagccaccggctgacagtggaggac
ccagtgactgtggagtacatcacccgctacattgcgagtctgaagcagcgttatacacag
agcaatgggcgcaggccatttggtatctcggccctaattgtgggttttgactttgatggc
actcccagactctatcagactgacccctcgggcacataccatgcttggaaggccaatgcc
ataggccggggcgccaagtcagtgcgtgaatttctggagaagaactacacagatgatgcc
attgaaacagatgatctgaccatcaaacttgtgatcaaggcactgttagaggtggtccag
tcaggtggcaaaaacatcgaacttgccgtcatgaggcgggatcagccgctcaagattcta
aatcctgaagaaattgagaagtatgttgctgaaattgagaaggagaaagaagaaaatgaa
aagaagaagcaaaagaaagcatcttga

KEGG   Mus musculus (mouse): 26445
Entry
26445             CDS       T01002                                 

Gene name
Psmb2, AU045357, AW108089, C7-I, D4Wsu33, D4Wsu33e, HC7-, HC7-I
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 2
  KO
K02734  20S proteasome subunit beta 4 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    26445 (Psmb2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26445 (Psmb2)
   05012 Parkinson disease
    26445 (Psmb2)
   05014 Amyotrophic lateral sclerosis
    26445 (Psmb2)
   05016 Huntington disease
    26445 (Psmb2)
   05017 Spinocerebellar ataxia
    26445 (Psmb2)
   05020 Prion disease
    26445 (Psmb2)
   05022 Pathways of neurodegeneration - multiple diseases
    26445 (Psmb2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26445 (Psmb2)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    26445 (Psmb2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     26445 (Psmb2)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   26445 (Psmb2)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    26445 (Psmb2)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 26445
NCBI-ProteinID: NP_036100
MGI: 1347045
Ensembl: ENSMUSG00000028837
Vega: OTTMUSG00000009281
UniProt: Q9R1P3
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
4 D2.2; 4 60.9 cM
AA seq 201 aa
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYI
QKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDY
LAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSV
RVIDKDGIHNLENIAFPKRDS
NT seq 606 nt   +upstreamnt  +downstreamnt
atggagtacctcattggcatccagggcccagactatgtcctcgtcgcttccgaccgagtg
gccgccagcaatattgtccagatgaaggacgatcatgacaagatgtttaagatgagtgaa
aaaatcttactcctatgtgttggagaggctggagacactgtacagtttgcagaatatatc
cagaaaaacgtgcaactttataaaatgcggaatggatatgaattgtctcccacagcagca
gctaacttcacacggcggaacctggctgactgtcttcggagtcggaccccatatcatgtg
aacctcctcctggctggctatgacgagcatgaagggccagccctttactacatggactac
ctggcagccttggctaaggctccttttgcagctcatggctatggtgcctttctgactctc
agcatccttgaccgatactacacacctaccatctcacgtgagagggcagtggagcttctt
aggaagtgtctggaggagctccagaagcgcttcatcttgaatctgcccaccttcagtgtc
cgggtcattgacaaagatggcatccacaatctggagaacattgccttccctaagcgggac
tcctaa

KEGG   Mus musculus (mouse): 26446
Entry
26446             CDS       T01002                                 

Gene name
Psmb3, AL033320, C10-, C10-II, D2Mgi4
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 3
  KO
K02735  20S proteasome subunit beta 3 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    26446 (Psmb3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    26446 (Psmb3)
   05012 Parkinson disease
    26446 (Psmb3)
   05014 Amyotrophic lateral sclerosis
    26446 (Psmb3)
   05016 Huntington disease
    26446 (Psmb3)
   05017 Spinocerebellar ataxia
    26446 (Psmb3)
   05020 Prion disease
    26446 (Psmb3)
   05022 Pathways of neurodegeneration - multiple diseases
    26446 (Psmb3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    26446 (Psmb3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    26446 (Psmb3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     26446 (Psmb3)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   26446 (Psmb3)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    26446 (Psmb3)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 26446
NCBI-ProteinID: NP_036101
MGI: 1347014
Ensembl: ENSMUSG00000069744
Vega: OTTMUSG00000002743
UniProt: Q9R1P1 Q545G0
Structure
PDB: 
3UNB 3UNF 3UNE 3UNH

Position
11 D; 11 61.07 cM
AA seq 205 aa
MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV
QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF
ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPNMDPEHLFETISQAMLNAVDRDAV
SGMGVIVHVIEKDKITTRTLKARMD
NT seq 618 nt   +upstreamnt  +downstreamnt
atgtctattatgtcctataatggaggggccgtcatggccatgaagggaaagaactgtgtg
gccatcgctgcagacagacgtttcgggatccaggcccagatggtgaccacggacttccag
aagatctttcccatgggtgacaggctctacataggcctggccggcctggccactgacgtc
cagacagttgcccagcgtctcaagttccgactgaacttgtatgagctgaaagaaggtcga
cagatcaagccttacaccctcatgagcatggtggccaacctcctgtatgagaagcggttc
ggtccctactacacagagcctgtcattgctggcctggacccgaagaccttcaagcccttc
atttgctctctggacctcattggctgtcccatggtgactgatgactttgtagtcagtggt
acctgctccgaacaaatgtatgggatgtgtgagtctctctgggagcccaacatggatcca
gaacacctgtttgaaaccatttctcaggccatgctgaacgcggtggaccgggatgccgtg
tcgggcatgggcgtcatcgtccacgtcattgagaaagacaagatcaccaccaggacgctg
aaggcccggatggactaa

KEGG   Mus musculus (mouse): 73677
Entry
73677             CDS       T01002                                 

Gene name
Psma8, 2410072D24Rik
Definition
(RefSeq) proteasome subunit alpha 8
  KO
K02731  20S proteasome subunit alpha 4 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    73677 (Psma8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    73677 (Psma8)
   05012 Parkinson disease
    73677 (Psma8)
   05014 Amyotrophic lateral sclerosis
    73677 (Psma8)
   05016 Huntington disease
    73677 (Psma8)
   05017 Spinocerebellar ataxia
    73677 (Psma8)
   05020 Prion disease
    73677 (Psma8)
   05022 Pathways of neurodegeneration - multiple diseases
    73677 (Psma8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    73677 (Psma8)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    73677 (Psma8)
   03051 Proteasome [BR:mmu03051]
    73677 (Psma8)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     73677 (Psma8)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   73677 (Psma8)
Membrane trafficking [BR:mmu04131]
 Endosome - Lysosome transport
  Rab GTPases and associated proteins
   Rab associated proteins
    73677 (Psma8)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    73677 (Psma8)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 73677
NCBI-ProteinID: NP_001157081
MGI: 1920927
Ensembl: ENSMUSG00000036743
UniProt: Q9CWH6
Position
18; 18 A1
AA seq 250 aa
MASRYDRAITVFSPDGHLFQVEYAQEAVKKGSTAVGIRGTNIVVLGVEKKSVAKLQDERT
VRKICALDDHVCMAFAGLTADARVVISRARVECQSHKLTVEDPVTVEYITRFIATLKQKY
TQSNGRRPFGISALIVGFDDDGIPRLYQTDPSGTYHAWKANAIGRSAKTVREFLEKNYTE
DAISNDKEAIKLAIKALLEVVQSGGKNIELAIIRRDQPLKMFSAKEIELEVSEIEREKDE
AEKTKSKKST
NT seq 753 nt   +upstreamnt  +downstreamnt
atggcttctcggtatgacagggcaatcaccgtcttctccccagatggacaccttttccaa
gtggagtatgcccaggaagcagtgaagaaaggctccaccgcggttggaattcgaggaact
aatatagttgtgcttggggtagaaaaaaagtcagtggccaagcttcaagatgaaaggact
gtgaggaaaatctgcgctctcgatgaccatgtctgcatggcttttgcaggtctgacagcg
gatgctagagtggtgatcagcagagcgcgggtggagtgccagagccacaagctcacagtg
gaggatcccgtcactgtagagtatataactcgcttcatagcgacgctaaagcagaaatat
acccagagcaatggacgaaggccttttggtatttcagccttaattgtaggctttgatgat
gatggcatcccaagattgtatcagacagatccctccgggacttaccacgcttggaaagca
aatgcaataggccgaagtgctaaaactgtccgggaatttctggaaaaaaattacacagaa
gatgcaatttcaaatgacaaggaagctatcaaattagcaataaaagctttgctcgaagtt
gtccagtctggcggaaagaacattgaactggctataataagaagagatcaacctttgaag
atgtttagtgccaaagaaattgaactggaggtgagtgaaatagaaagggaaaaggacgaa
gcagagaagacaaagtcaaagaagtcaacctaa

DBGET integrated database retrieval system