KEGG   Mus musculus (mouse): 19167Help
Entry
19167             CDS       T01002                                 

Gene name
Psma3, Lmpc8
Definition
(RefSeq) proteasome (prosome, macropain) subunit, alpha type 3
  KO
K02727  20S proteasome subunit alpha 7 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19167 (Psma3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19167 (Psma3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19167 (Psma3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19167 (Psma3)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   19167 (Psma3)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    19167 (Psma3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Proteasome_A_N
Motif
Other DBs
NCBI-GeneID: 19167
NCBI-ProteinID: NP_035314
MGI: 104883
Ensembl: ENSMUSG00000060073
Vega: OTTMUSG00000035110
UniProt: O70435 Q58EV4
Structure
PDB: 

Position
12; 12 C2
AA seq 255 aa AA seqDB search
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSANDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgagctccatcggcactgggtatgacttgtcagcctctacgttctctcctgatggaaga
gttttccaagttgaatatgccatgaaggctgtggaaaacagtagtacagctattgggatc
agatgtaaagatggtgttgtgtttggggtagaaaaactagtcctttctaaactttatgaa
gaaggctccaataaacgtctttttaatgttgatcgacatgttggaatggcagttgcaggt
ttgctggcagatgctcgttcattagcagacatagcgagagaagaagcatccaactttagg
tccaacttcggctataacattcctctaaaacatcttgcagacagagtggccatgtatgta
cacgcctatacactctacagcgctgttagaccttttggctgcagtttcatgttggggtct
tacagtgcgaatgatggtgcacagctctatatgatcgacccatcaggtgtttcatatggt
tactggggctgtgcgattggcaaagccaggcaggctgcaaagacagagatagaaaagctt
cagatgaaggaaatgacttgccgtgatgtagttaaagaagttgcaaaaataatttacata
gtacacgatgaagttaaggataaagcttttgaactggagctcagctgggttggtgaatta
actaaaggaagacatgaaattgttcccaaagacataagagaggaagcagagaaatatgcc
aaggaatctttgaaggaagaagatgaatcagatgatgacaatatgtaa

DBGET integrated database retrieval system