KEGG   Mus musculus (house mouse): 19167
Entry
19167             CDS       T01002                                 
Symbol
Psma3, Lmpc8
Name
(RefSeq) proteasome subunit alpha 3
  KO
K02727  20S proteasome subunit alpha 7 [EC:3.4.25.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19167 (Psma3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19167 (Psma3)
   05012 Parkinson disease
    19167 (Psma3)
   05014 Amyotrophic lateral sclerosis
    19167 (Psma3)
   05016 Huntington disease
    19167 (Psma3)
   05017 Spinocerebellar ataxia
    19167 (Psma3)
   05020 Prion disease
    19167 (Psma3)
   05022 Pathways of neurodegeneration - multiple diseases
    19167 (Psma3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19167 (Psma3)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19167 (Psma3)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19167 (Psma3)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   19167 (Psma3)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   alpha type subunits
    19167 (Psma3)
SSDB
Motif
Pfam: Proteasome Proteasome_A_N
Other DBs
NCBI-GeneID: 19167
NCBI-ProteinID: NP_035314
MGI: 104883
Ensembl: ENSMUSG00000060073
UniProt: O70435 Q58EV4
Structure
Position
12:71016057..71042651
AA seq 255 aa
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCSFMLGSYSANDGAQLYMIDPSGVSYGYWGCAIGKARQAAKTEIEKL
QMKEMTCRDVVKEVAKIIYIVHDEVKDKAFELELSWVGELTKGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
NT seq 768 nt   +upstreamnt  +downstreamnt
atgagctccatcggcactgggtatgacttgtcagcctctacgttctctcctgatggaaga
gttttccaagttgaatatgccatgaaggctgtggaaaacagtagtacagctattgggatc
agatgtaaagatggtgttgtgtttggggtagaaaaactagtcctttctaaactttatgaa
gaaggctccaataaacgtctttttaatgttgatcgacatgttggaatggcagttgcaggt
ttgctggcagatgctcgttcattagcagacatagcgagagaagaagcatccaactttagg
tccaacttcggctataacattcctctaaaacatcttgcagacagagtggccatgtatgta
cacgcctatacactctacagcgctgttagaccttttggctgcagtttcatgttggggtct
tacagtgcgaatgatggtgcacagctctatatgatcgacccatcaggtgtttcatatggt
tactggggctgtgcgattggcaaagccaggcaggctgcaaagacagagatagaaaagctt
cagatgaaggaaatgacttgccgtgatgtagttaaagaagttgcaaaaataatttacata
gtacacgatgaagttaaggataaagcttttgaactggagctcagctgggttggtgaatta
actaaaggaagacatgaaattgttcccaaagacataagagaggaagcagagaaatatgcc
aaggaatctttgaaggaagaagatgaatcagatgatgacaatatgtaa

DBGET integrated database retrieval system