KEGG   Mus musculus (house mouse): 19170
Entry
19170             CDS       T01002                                 
Symbol
Psmb1, Lmpc5
Name
(RefSeq) proteasome (prosome, macropain) subunit, beta type 1
  KO
K02732  20S proteasome subunit beta 6 [EC:3.4.25.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19170 (Psmb1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19170 (Psmb1)
   05012 Parkinson disease
    19170 (Psmb1)
   05014 Amyotrophic lateral sclerosis
    19170 (Psmb1)
   05016 Huntington disease
    19170 (Psmb1)
   05017 Spinocerebellar ataxia
    19170 (Psmb1)
   05020 Prion disease
    19170 (Psmb1)
   05022 Pathways of neurodegeneration - multiple diseases
    19170 (Psmb1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19170 (Psmb1)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19170 (Psmb1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19170 (Psmb1)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   19170 (Psmb1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    19170 (Psmb1)
SSDB
Motif
Pfam: Proteasome Cytochrom_C1 FAM165
Other DBs
NCBI-GeneID: 19170
NCBI-ProteinID: NP_035315
MGI: 104884
Ensembl: ENSMUSG00000014769
Position
17:complement(15695983..15718538)
AA seq 240 aa
MLSTAAYRDVERELGMGPHGSAGPVQLRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEGF
SIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLS
TILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQV
GFKNMQNVEHVPLTLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD
NT seq 723 nt   +upstreamnt  +downstreamnt
atgctttccactgctgcttaccgagacgtggaacgagagctgggaatggggcctcacggc
tccgccggccctgtgcagctgcggttttcgccttatgccttcaacggaggtactgtattg
gcaattgctggagaagatttttccatcgtcgcttcagacactcgattgagtgaaggattt
tcaattcatacccgagatagccccaaatgctacaaactgacagacaagacagtaattggc
tgcagtggtttccatggagattgtctcactttgacaaagattattgaagcaagattaaag
atgtacaagcattccaataacaaggccatgacaacgggggcgattgctgcaatgctgtct
accatcctgtactcacggcgcttcttcccttactatgtttacaacatcattggaggactt
gatgaagaaggaaagggagctgtgtacagctttgacccagtgggctcttaccagagagac
tctttcaaggcgggaggctcagcaagtgccatgctgcagcctctgctcgacaaccaggtt
ggcttcaaaaatatgcagaatgtagagcacgtccccctgacgctggacagagccatgagg
ctggtgaaagatgtcttcatttctgcagccgagagggatgtgtatactggagatgctctc
aggatctgcatcgtgaccaaagagggcatcagggaggaaactgttcccctgcggaaagac
tga

DBGET integrated database retrieval system