KEGG   Mus musculus (mouse): 19171Help
Entry
19171             CDS       T01002                                 

Gene name
Psmb10, Mecl-1, Mecl1
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 10
  KO
K02733  20S proteasome subunit beta 10 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
Module
mmu_M00337  Immunoproteasome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19171 (Psmb10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:mmu01002]
    19171 (Psmb10)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19171 (Psmb10)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19171 (Psmb10)
Peptidases [BR:mmu01002]
 Threonine Peptidases
  Family T1: proteasome family
   19171 (Psmb10)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    19171 (Psmb10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Pr_beta_C
Motif
Other DBs
NCBI-GeneID: 19171
NCBI-ProteinID: NP_038668
MGI: 1096380
Ensembl: ENSMUSG00000031897
Vega: OTTMUSG00000062064
UniProt: O35955
Structure
PDB: 

Position
8 D3; 8 53.06 cM
AA seq 273 aa AA seqDB search
MLKQAVEPTGGFSFENCQRNASLEHVLPGLRVPHARKTGTTIAGLVFRDGVILGADTRAT
NDSVVADKSCEKIHFIAPKIYCCGAGVAADTEMTTRMAASKMELHALSTGREPRVATVTR
ILRQTLFRYQGHVGASLVVGGVDLNGPQLYEVHPHGSYSRLPFTALGSGQGAAVALLEDR
FQPNMTLEAAQELLVEAITAGILSDLGSGGNVDACVITAGGAKLQRALSTPTEPVQRAGR
YRFAPGTTPVLTREVRPLTLELLEETVQAMEVE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagcaggcagtggaacccacaggaggcttctctttcgagaactgccagaggaat
gcgtccttggaacacgtccttccgggacttcgggttcctcatgcacgcaagaccgggact
accatcgcggggcttgtgttccgagatggagtcatcctgggagcggacacgcgggccact
aacgattcggttgtggcggacaaaagctgcgagaagatccacttcatcgcccctaaaatc
tactgctgtggggctggagtagctgcggacactgagatgactacgcggatggcagcttcc
aagatggaactacatgcgctgtccaccggccgtgagcctcgggtggccacggtcacccgt
atcctgcgccagacgcttttccggtaccaaggccacgtgggggcatcactggtcgtgggc
ggggttgatttgaacggacctcagctctacgaggtgcacccacatggttcctacagccgt
ctgccctttactgcccttggctctggtcagggtgcagccgtggcactgttggaagaccgg
ttccagccaaacatgacgctggaggctgcgcaagagctgttggtggaagccatcacagca
gggatcctgagtgacctgggctctgggggcaatgtggatgcctgtgtgatcactgcaggg
ggtgccaagctgcagagagcattgagcacccccaccgagcctgtgcagagagctggccgt
taccgatttgctcctggaaccacacctgtcctgacccgggaagtgagacccctgaccctg
gaacttcttgaggaaactgtgcaggccatggaggtggaatga

DBGET integrated database retrieval system