KEGG   Mus musculus (house mouse): 19172
Entry
19172             CDS       T01002                                 
Symbol
Psmb4, Pros-27
Name
(RefSeq) proteasome (prosome, macropain) subunit, beta type 4
  KO
K02736  20S proteasome subunit beta 7 [EC:3.4.25.1]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu03050  Proteasome
mmu05010  Alzheimer disease
mmu05012  Parkinson disease
mmu05014  Amyotrophic lateral sclerosis
mmu05016  Huntington disease
mmu05017  Spinocerebellar ataxia
mmu05020  Prion disease
mmu05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19172 (Psmb4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    19172 (Psmb4)
   05012 Parkinson disease
    19172 (Psmb4)
   05014 Amyotrophic lateral sclerosis
    19172 (Psmb4)
   05016 Huntington disease
    19172 (Psmb4)
   05017 Spinocerebellar ataxia
    19172 (Psmb4)
   05020 Prion disease
    19172 (Psmb4)
   05022 Pathways of neurodegeneration - multiple diseases
    19172 (Psmb4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mmu01002]
    19172 (Psmb4)
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19172 (Psmb4)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19172 (Psmb4)
Peptidases and inhibitors [BR:mmu01002]
 Threonine peptidases
  Family T1: proteasome family
   19172 (Psmb4)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    19172 (Psmb4)
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 19172
NCBI-ProteinID: NP_032971
MGI: 1098257
Ensembl: ENSMUSG00000005779
UniProt: P99026
Structure
Position
3:complement(94791635..94794269)
AA seq 264 aa
MEAFWESRAGHWAGGPAPGQFYRIPATPSGLMDPASAPCEGPITRTQNPMVTGTSVLGVK
FDGGVVIAADMLGSYGSLARFRNISRIMRVNDSTMLGASGDYADFQYLKQVLGQMVIDEE
LLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAP
SLATGYGAYLAQPLLREVLEKQPVLSQTEARELVERCMRVLYYRDARSYNRFQIATVTEK
GVEIEGPLSAQTNWDIAHMISGFE
NT seq 795 nt   +upstreamnt  +downstreamnt
atggaagcgttttgggagtcacgggctggccactgggccgggggtccggctccagggcag
ttttaccgcatcccggccacccccagcggcctcatggacccggcgtcggcgccctgcgag
ggtcccatcactcggacccagaaccccatggtgaccgggacatcggtactcggggtgaag
ttcgacggcggagtggtgattgctgcagacatgctgggctcctacggctccctggctcgt
ttccgcaatatctctcgtattatgcgagtcaacgacagcactatgctgggtgcctcggga
gactacgctgatttccagtatttgaaacaagttctcggccagatggtgattgatgaagag
ctgttgggagatggacacagctatagccctagagctattcattcatggttgacaagagcc
atgtacagccgccgctccaagatgaatcccctgtggaacaccatggtcattggaggctat
gctgacggagaaagcttcctcggttatgtggacatgcttggtgtagcttatgaagcccct
tcactggccactggttatggtgcatacttggctcagcctctgcttcgagaagttctagag
aagcagccagtgctgagtcagactgaggctcgggagcttgtggagcgctgcatgagagtg
ctgtactacagagatgcccgttcgtataaccggtttcaaattgccactgtgactgaaaag
ggtgtcgagatagaaggaccgctgtccgcacagaccaactgggacatcgctcacatgatc
agtggctttgaatga

DBGET integrated database retrieval system