KEGG   Mus musculus (mouse): 19186
Entry
19186             CDS       T01002                                 

Gene name
Psme1, AW413925, PA, PA28a
Definition
(RefSeq) proteasome (prosome, macropain) activator subunit 1 (PA28 alpha)
  KO
K06696  proteasome activator subunit 1 (PA28 alpha)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19186 (Psme1)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    19186 (Psme1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19186 (Psme1)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    19186 (Psme1)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 19186
NCBI-ProteinID: NP_035319
MGI: 1096367
Ensembl: ENSMUSG00000022216
Vega: OTTMUSG00000037625
UniProt: P97371 Q5HZK3
Structure
PDB: 
5MX5 5MSJ

Position
14 C3; 14 28.19 cM
AA seq 249 aa
MATLRVHPEAQAKVDVFREDLCSKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAP
LDIPVPDPVKEKEKEERKKQQEKEEKEEKKKGDEDDKGPPCGPVNCNEKIVVLLQRLKPE
IKDVTEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTNLHTKLEGFHTQISKYFSE
RGDAVAKAAKQPHVGDYRQLVHELDEAEYQEIRLMVMEIRNAYAVLYDIILKNFEKLKKP
RGETKGMIY
NT seq 750 nt   +upstreamnt  +downstreamnt
atggccacactgagggtccatcccgaagcccaagccaaggtggatgtgttccgtgaagac
ctgtgtagcaagacagagaacctgcttgggagctattttcccaagaaaatctcagagttg
gatgcgttcttaaaggagccagctctcaatgaagccaacctgagcaatctgaaggctcca
ttggacatcccagtacccgatccagtcaaagagaaagagaaggaggagcggaagaagcaa
caggagaaggaagagaaggaagagaagaagaaaggggacgaagacgacaaaggtcccccc
tgtggcccagtgaactgcaatgagaagattgtggtcctcctgcaacgcctaaaacctgag
atcaaggatgtcactgagcaactcaatctggtcactacctggttgcagctacagatacct
cggatagaggatgggaataattttggcgtggctgtccaggaaaaggtgtttgagctgatg
accaaccttcacaccaagctggaaggcttccacacgcagatctccaagtacttctccgag
aggggtgacgccgtggccaaagcagccaagcagccccacgtgggtgactatcggcagctg
gtgcacgagctggacgaggcggagtaccaggagatccgtctgatggtcatggagatccga
aatgcttatgctgtgttatatgacatcatcctgaagaactttgagaagctcaagaagccc
cgtggagaaaccaagggaatgatctattga

KEGG   Mus musculus (mouse): 19188
Entry
19188             CDS       T01002                                 

Gene name
Psme2, AA589371, AI788882, PA2, PA28b
Definition
(RefSeq) proteasome (prosome, macropain) activator subunit 2 (PA28 beta)
  KO
K06697  proteasome activator subunit 2 (PA28 beta)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19188 (Psme2)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    19188 (Psme2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19188 (Psme2)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    19188 (Psme2)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 19188
NCBI-ProteinID: NP_035320
MGI: 1096365
Ensembl: ENSMUSG00000079197
Vega: OTTMUSG00000034667
UniProt: P97372 Q5SVP3
Structure
PDB: 
5MX5 5MSK

Position
14 C3; 14 28.19 cM
AA seq 239 aa
MAKPCGVRLSGEARKQVDVFRQNLFQEADDFLCTFLPRKIISLSQLLQEDSLNVADLSSL
RAPLDIPIPDPPPKDDEMETDKQEKKEVPKCGYLPGNEKLLALLALVKPEVWTLKEKCIL
VITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASK
DTHVMDYRALVHERDEAAYGALRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEKPSMY
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccaagccttgtggggtccgcttgagtggagaagcccgaaaacaggtggatgtcttc
agacaaaatcttttccaggaggctgatgacttcctctgcactttcttgccacggaaaatc
atatccctgagtcagctcttgcaggaggattccctcaatgtggccgacctctcctccctc
cgggctcctctggacatccctatcccagatcctccacccaaggatgacgagatggaaaca
gacaagcaggagaagaaggaagtccctaagtgtggctacctcccggggaacgagaagctt
ctggccttgctcgctttggttaagccagaagtctggactctcaaagagaagtgcattctg
gtaatcacatggatccagcacctgatccccaagattgaggatggaaatgattttggggtg
gcaattcaggagaaggtgctggagagagtgaatgctgtcaagaccaaagtagaagctttc
cagacaaccatttccaagtacttctcagaacgaggggacgctgtagccaaggcttccaag
gacacccatgtaatggattaccgggccttggtgcatgagcgagatgaagcagcctatggg
gcgcttagggccatggtgctggacctgagggccttctatgctgagctttatcatatcatc
agcagcaacctagagaaaatcgtcaacccgaagggtgaagaaaagccatcgatgtactga

KEGG   Mus musculus (mouse): 19192
Entry
19192             CDS       T01002                                 

Gene name
Psme3, AA410043, AU020960, K, Ki, PA28gamma, REGga, REGgamma, pa2, pa28g
Definition
(RefSeq) proteaseome (prosome, macropain) activator subunit 3 (PA28 gamma, Ki)
  KO
K06698  proteasome activator subunit 3 (PA28 gamma)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu04612  Antigen processing and presentation
mmu05160  Hepatitis C
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    19192 (Psme3)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    19192 (Psme3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05160 Hepatitis C
    19192 (Psme3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    19192 (Psme3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mmu04147]
    19192 (Psme3)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    19192 (Psme3)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19192 (Psme3)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 19192
NCBI-ProteinID: NP_035322
MGI: 1096366
Ensembl: ENSMUSG00000078652
Vega: OTTMUSG00000002795
UniProt: P61290 Q4FK54
Position
11 D; 11 64.67 cM
AA seq 254 aa
MASLLKVDQEVKLKVDSFRERITSEAEDLVANFFPKKLLELDSFLKEPILNIHDLTQIHS
DMNLPVPDPILLTNSHDGLDGPTYKKRRLDECEEAFQGTKVFVMPNGMLKSNQQLVDIIE
KVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEETVAELRTVESEAASYLDQIS
RYYITRAKLVSKIAKYPHVEDYRRTVTEIDEKEYISLRLIISELRNQYVTLHDMILKNIE
KIKRPRSSNAETLY
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcctcgttgctgaaggtggatcaggaagtgaagctcaaggttgattctttcagagag
cggatcacaagtgaggcagaagacttggtggcaaattttttcccaaagaagttactagaa
cttgatagttttttgaaggaaccaattctaaatatccatgacctaactcagatccactca
gacatgaacctcccagtccctgaccccattctcctcaccaatagccacgatggactggat
ggtcccacttacaagaagcgcaggttggatgaatgtgaagaggcctttcaaggaaccaag
gtgtttgtgatgcccaatgggatgttgaaaagcaaccagcagcttgtggacattattgag
aaagtaaaacccgagattcggctgctgatcgagaaatgtaacacggtcaaaatgtgggtt
cagctgttgattcccagaatagaagatgggaacaacttcggggtatcaattcaggaggaa
acagttgctgaactaagaactgtggagagtgaagccgcatcttacctggaccagatttct
agatattatattacaagagccaaattggtttctaaaatagctaaatatccccatgtggag
gactatcgccgcactgtcacagagattgatgagaaagaatacatcagcctccggctcatc
atctcagagctgaggaatcagtatgtcactctccatgacatgatcctgaaaaacattgag
aagatcaaacggccccggagcagcaatgcagagacactgtactga

KEGG   Mus musculus (mouse): 621823
Entry
621823            CDS       T01002                                 

Gene name
Psme2b, PA28, PA28b-p, PA28b2, Psme, Psme2, Psme2-, Psme2-like, Psme2b-ps
Definition
(RefSeq) protease (prosome, macropain) activator subunit 2B
  KO
K06697  proteasome activator subunit 2 (PA28 beta)
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
mmu04612  Antigen processing and presentation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    621823 (Psme2b)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    621823 (Psme2b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:mmu03051]
    621823 (Psme2b)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Regulatory particles
   PA28 (11S REG)
    621823 (Psme2b)
SSDB
Motif
Pfam: PA28_beta PA28_alpha
Other DBs
NCBI-GeneID: 621823
NCBI-ProteinID: NP_001268401
MGI: 1341073
Ensembl: ENSMUSG00000078153
Vega: OTTMUSG00000005530
UniProt: P97372 Q5SVP3
Structure
PDB: 
5MX5 5MSK

Position
11; 11 B1.2
AA seq 239 aa
MAKPCGVRLSGEARKQVDVFRQNLFQEADDFLCTFLPRKIISLSQLLQEDSLNVADLSSL
RAPLDIPIPDPPPKDDEMETDKQEKKEVPKCGYLPGNEKLLALLALVKPEVWTLKEKCIL
VITWIQHLIPKIEDGNDFGVAIQEKVLERVNAVKTKVEAFQTTISKYFSERGDAVAKASK
DTHVMDYRALVHERDEAAYGALRAMVLDLRAFYAELYHIISSNLEKIVNPKGEEKPSMY
NT seq 720 nt   +upstreamnt  +downstreamnt
atggccaagccttgtggggtccgcttgagtggagaagcccgaaaacaggtggatgtcttc
agacaaaatcttttccaggaggctgatgacttcctctgcactttcttgccacggaaaatc
atatccctgagtcagctcttgcaggaggattccctcaatgtggccgacctctcctccctc
cgggctcctctggacatccctatcccagatcctccacccaaggatgacgagatggaaaca
gacaagcaggagaagaaggaagtccctaagtgtggctacctcccggggaacgagaagctt
ctggccttgcttgctttggttaagccagaagtctggactctcaaagagaagtgcattctg
gtaatcacgtggatccagcacctgatccccaagattgaggatggaaatgattttggggtg
gcaattcaggagaaggtgctggagagagtgaatgctgtcaagaccaaagtagaagctttc
cagacaactatttccaagtacttctcagaacgaggggatgctgtagccaaggcttccaag
gatacccatgtaatggattaccgggccttggtgcatgagcgagatgaagcagcctatggg
gcgcttagggccatggtgctggacctgagggccttctatgctgagctttatcatatcatc
agcagcaacctagagaaaatcgtcaacccgaagggtgaagaaaagccatcgatgtactga

DBGET integrated database retrieval system