KEGG   Mus musculus (mouse): 19193
Entry
19193             CDS       T01002                                 

Gene name
Pipox, LPIPOX, Pso
Definition
(RefSeq) pipecolic acid oxidase
  KO
K00306  sarcosine oxidase / L-pipecolate oxidase [EC:1.5.3.1 1.5.3.7]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu00310  Lysine degradation
mmu01100  Metabolic pathways
mmu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    19193 (Pipox)
   00310 Lysine degradation
    19193 (Pipox)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    19193 (Pipox)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.1  sarcosine oxidase
     19193 (Pipox)
    1.5.3.7  L-pipecolate oxidase
     19193 (Pipox)
SSDB
Motif
Pfam: DAO NAD_binding_8 HI0933_like FAD_binding_2 Pyr_redox_2 GIDA ApbA FAD_oxidored
Other DBs
NCBI-GeneID: 19193
NCBI-ProteinID: NP_032978
MGI: 1197006
Ensembl: ENSMUSG00000017453
Vega: OTTMUSG00000000072
UniProt: Q9D826 Q3UEJ8
Position
11 B5; 11 46.74 cM
AA seq 390 aa
MAAQTDFWDAIVIGAGIQGCFTAYHLAKHSKSVLLLEQFFLPHSRGSSHGQSRIIRKAYP
EDFYTMMMKECYQTWAQLEREAGTQLHRQTELLLLGTKENPGLKTIQATLSRQGIDHEYL
SSVDLKQRFPNIRFTRGEVGLLDKTGGVLYADKALRALQHIICQLGGTVCDGEKVVEIRP
GLPVTVKTTLKSYQANSLVITAGPWTNRLLHPLGIELPLQTLRINVCYWREKVPGSYGVS
QAFPCILGLDLAPHHIYGLPASEYPGLMKICYHHGDNVDPEERDCPKTFSDIQDVQILCH
FVRDHLPGLRAEPDIMERCMYTNTPDEHFILDCHPKYDNIVIGAGFSGHGFKLAPVVGKI
LYELSMKLPPSYDLAPFRMSRFSTLSKAHL
NT seq 1173 nt   +upstreamnt  +downstreamnt
atggctgctcagacagatttctgggatgctattgtgattggagcaggcatccagggctgc
tttaccgcgtaccacctggccaaacactccaagagcgtcctcctgctggagcagttcttt
cttccccattcccgaggaagctcacatggacagagccgcataatcagaaaggcttatcca
gaggacttctacacgatgatgatgaaggaatgttatcagacatgggcccagctggagcgt
gaagccggaacccagttacacaggcagactgagctcttacttctggggacgaaggaaaat
ccaggattaaagacaatccaggccaccctgtctaggcaagggatcgaccatgagtatctt
tcgtcagtggatttaaagcaacgctttccaaacattcggttcaccaggggagaagtgggg
ctcttggacaagactggaggtgtcctctatgcagacaaggccctcagagccctccagcat
ataatttgtcagctaggaggcactgtgtgtgatggagagaaggtagtggagataagacct
ggtctacccgtcacagtgaaaaccaccttgaagagctaccaagccaacagcttggtcatc
actgctggtccctggaccaaccggcttctgcatcctctggggattgagttgcctctccag
acccttaggatcaatgtgtgttactggcgagagaaggtccctgggagctatggtgtatca
caagcttttccatgcatcctgggtctggatctggccccccaccacatctatggactgcca
gcatccgagtacccggggctgatgaagatctgctatcaccatggtgacaatgtggaccca
gaggagcgggactgccccaaaaccttctcagacatccaagacgttcaaattctatgccac
tttgtcagagatcatttaccaggcctgcgggctgagccagacatcatggaacgctgcatg
tacacgaatactcctgatgagcactttattcttgattgccacccaaagtatgacaacatt
gtcatcggcgctggattctctggacatggattcaagttggcccctgttgtggggaagatc
ctctatgagctaagcatgaaattacccccatcctatgacttggctccgtttcgaatgagt
cgcttctctacgctgagcaaagcccacctttga

DBGET integrated database retrieval system