KEGG   Mus musculus (mouse): 19201
Entry
19201             CDS       T01002                                 

Symbol
Pstpip2, MAYP, cmo
Name
(RefSeq) proline-serine-threonine phosphatase-interacting protein 2
  KO
K20124  proline-serine-threonine phosphatase interacting protein 2
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mmu04131]
    19201 (Pstpip2)
Membrane trafficking [BR:mmu04131]
 Endocytosis
  Bin/Amphiphysin/Rvs (BAR) family proteins
   F-BAR proteins
    19201 (Pstpip2)
SSDB
Motif
Pfam: FCH Rad9_Rad53_bind Snapin_Pallidin
Other DBs
NCBI-GeneID: 19201
NCBI-ProteinID: NP_038859
MGI: 1335088
Ensembl: ENSMUSG00000025429
UniProt: Q99M15
Position
18 E3; 18 52.38 cM
AA seq 334 aa
MTGSLFKGNFWSTDILSTIGYDSIIQHLNNGRKNCKEFEDFLKERASIEEKYGKDLLNLS
RKKPCGQSEINTLKRALEVFKQQVDNVAQCHIQLAQTLREEARKMEEFREKQKLQRKKTE
TIMDAAHKQRNAQFKKAMDAKKNYEQKCRDKDEAEQAVHRSANVANQRQQEKLFVKLATS
KTAVEDSDKAYMLHINMLEKVREDWQSEHIKACEVFEAQECERINFFRNALWLHLNQLSQ
QCVANDEMYEQVRKSLETCSIEKDIQYFVNQRKTGQTPPAPIMYENFYSPQRNAAPPGKT
TGPNPARRGPLPVPKRIPDDPDYSVVEDYSLLYQ
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgacgggctcgctgttcaaggggaacttctggagcacggacattctcagcaccattggc
tacgacagcattatccagcacctgaacaatggccgtaagaactgcaaggagtttgaagac
tttttgaaagaaagagcatcaattgaagagaaatatggcaaagacctgctgaacctctcc
aggaagaagccgtgtggacagtctgagatcaataccttgaagagagcccttgaggtcttc
aagcagcaagtagacaacgtggctcaatgtcacattcagcttgcgcagactctaagagaa
gaggccaggaagatggaagaattccgggaaaagcagaagctgcagcggaaaaagacagaa
acaataatggatgctgcccacaagcaaaggaacgcacagttcaagaaagccatggatgcc
aagaagaattatgagcaaaagtgccgggacaaggatgaggcagagcaagctgtccaccgc
agcgccaatgtggccaaccaacggcaacaagaaaagctttttgtgaaactggccacttca
aagactgcagtagaggattcagacaaagcgtacatgttgcacatcaacatgctggagaag
gttcgagaagactggcagagtgaacacattaaggcctgcgaggtgttcgaggctcaggaa
tgtgaacgaatcaacttcttccggaatgcactgtggttgcatctgaatcagctgtcacaa
caatgtgtcgcaaatgacgagatgtatgagcaagtccgtaagagtttagaaacatgcagc
attgagaaggacatccagtattttgtgaaccagcggaaaactggacagactcccccagca
cccatcatgtatgagaacttctactctcctcagcggaatgctgccccaccaggaaagact
acagggcccaatccagcaaggagaggacctctccctgtccctaagcggataccagatgat
cctgattactctgtggttgaagattacagtttgctctatcagtga

DBGET integrated database retrieval system