KEGG   Mus musculus (mouse): 19208
Entry
19208             CDS       T01002                                 

Gene name
Ptcra, gp33, pT, pT-, pT-alpha, pT-alpha-TCR, pT[, pT[a], pTa, pTalpha
Definition
(RefSeq) pre T cell antigen receptor alpha
  KO
K06056  pre T-cell antigen receptor alpha
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04330  Notch signaling pathway
mmu05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    19208 (Ptcra)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    19208 (Ptcra)
SSDB
Motif
Pfam: PTCRA
Other DBs
NCBI-GeneID: 19208
NCBI-ProteinID: NP_035325
MGI: 104857
Ensembl: ENSMUSG00000036858
Vega: OTTMUSG00000045088
UniProt: P0C6B2 A0A0R4J0F4
Position
17; 17 C
AA seq 206 aa
MLLHEWAMARTWLLLLLGVRCQALPSGIAGTPFPSLAPPITLLVDGRQHMLVVCLVLDAA
PPGLDNPVWFSAGNGSALDAFTYGPSLAPDGTWTSLAQLSLPSEELEAWEPLVCHTRPGA
GGQNRSTHPLQLSGESSTARSCFPEPLGGTQRQVLWLSLLRLLLFKLLLLDVLLTCSHLR
LHVLAGQHLQPPPSRKSLPPTHRIWT
NT seq 621 nt   +upstreamnt  +downstreamnt
atgcttctccacgagtgggccatggctaggacatggctgctgctgcttctgggcgtcagg
tgtcaggctctaccatcaggcatcgctggcaccccctttccgtctctggctccacccatc
acactgctggtagatggaaggcagcacatgctggtggtttgcctggtcctcgatgcggca
ccccctggccttgacaaccctgtctggttctcagctggcaatggcagtgccctagacgcc
ttcacctatgggccctctctggcaccggacggcacctggactagcctggcccagctctcc
ttgccttctgaagagctggaagcctgggagcccttggtctgtcacaccaggcctggggct
gggggacagaaccggagcacacaccccctccagctgtcaggggaatcttcgacagccagg
agctgctttccggagcctctcggggggacacagcggcaggtactgtggctgagcctactg
cgcctgctcctcttcaaactgcttctgctcgatgtgctcctgacctgcagccacctccgc
ctccatgtgctggcgggccagcacctccagccaccaccctcacgcaagtccctgcctccc
acccacagaatttggacatag

DBGET integrated database retrieval system