KEGG   Mus musculus (house mouse): 19210
Entry
19210             CDS       T01002                                 
Symbol
Ptdss1, AU044268, AW539008, PSS-1, mKIAA0024
Name
(RefSeq) phosphatidylserine synthase 1
  KO
K08729  phosphatidylserine synthase 1 [EC:2.7.8.-]
Organism
mmu  Mus musculus (house mouse)
Pathway
mmu00564  Glycerophospholipid metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    19210 (Ptdss1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.-
     19210 (Ptdss1)
SSDB
Motif
Pfam: PSS DUF6350 Cyt_b-c1_8
Other DBs
NCBI-GeneID: 19210
NCBI-ProteinID: NP_032985
MGI: 1276575
Ensembl: ENSMUSG00000021518
UniProt: Q99LH2
Position
13:67080894..67146465
AA seq 473 aa
MASCVGSRTLSKDDVNYRMHFRMINEQQVEDITIDFFYRPHTITLLSFTIISLMYFAFTR
DDSVPEDNIWRGILSVIFFFLIISVLAFPNGPFTRPHPALWRMVFGLSVLYFLFLVFLLF
LNFEQVKSLMYWLDPNLRYATREADIMEYAVNCHVITWERIVSHFDIFAFGHFWGWAMKA
LLIRSYGLCWTISITWELTELFFMHLLPNFAECWWDQVILDILLCNGGGIWLGMVVCRFL
EMRTYHWASFKDIHTTTGKIKRAVLQFTPASWTYVRWFDPKSSFQRVAGIYLFMIIWQLT
ELNTFFLKHIFVFQASHPLSWGRILFIGCITAPTVRQYYAYLTDTQCKRVGTQCWVFGVI
GFLEAIVCIKFGQDLFSKTQILYVMLWLLCVAFTTFLCLYGMVWYAEHYGHREKTYSECE
DGTYSPEISWHHGKGSKGSEDSPPKHSSNHESHSSRRRNRHSKSKVTNGVGKK
NT seq 1422 nt   +upstreamnt  +downstreamnt
atggcgtcctgcgtggggagcaggactctgagcaaggatgatgtgaactacaggatgcat
ttccgcatgatcaacgagcagcaagtggaggacatcaccatagacttcttctaccggccg
cacaccatcaccctgctcagcttcaccatcatcagcctcatgtacttcgccttcaccagg
gatgactctgttccggaagacaacatctggagaggcatcctgtctgttatcttcttcttt
ctcatcatcagcgtgttagcattccccaatggtccatttactcgacctcatccagcctta
tggcgaatggtttttggtctcagtgtgttgtatttcctcttcttggtattcctccttttc
ctgaacttcgagcaggttaaatccctgatgtattggctggatcccaatcttcgatatgct
acacgagaagcggacatcatggagtatgctgtgaactgtcatgtgataacctgggagaga
atcgttagtcactttgatatatttgcatttggccatttctggggctgggccatgaaggcc
ttgttgatccgtagttatgggctttgctggacaatcagtatcacctgggagctgacagag
cttttcttcatgcatctcctgcccaattttgctgagtgctggtgggaccaagtcattctg
gacatcctgttgtgcaatggtggtggaatctggctgggcatggtcgtttgccggtttctg
gagatgagaacttaccactgggcaagcttcaaggacatccacaccaccacagggaagatc
aagcgagctgtgctgcagttcacccctgctagctggacttacgtcaggtggtttgatccc
aagtcttcctttcagagagtggctggtatatacctcttcatgatcatatggcagttgact
gagttgaataccttcttcttgaagcacatctttgtgttccaagccagccatcccttaagc
tggggtagaatcctcttcatcggctgcattacggctcccacagtgagacagtactatgcc
tacctcacggacacacagtgcaagcgtgtagggacacagtgctgggtgtttggggtcatt
ggtttcctggaagctattgtttgcataaaatttggacaagatctcttttctaagacccag
atactctatgtgatgctttggcttctttgtgtggccttcaccacgttcctgtgtctgtac
ggcatggtttggtatgcagagcactatggtcaccgggaaaagacctattcagagtgtgaa
gatggcacttacagtccagagatctcctggcatcatgggaaaggctccaaaggttctgaa
gacagcccaccgaagcattcaagcaaccacgaaagccattcttccagaagaaggaaccgg
cattctaagtccaaagtcactaatggagttggaaagaaatga

DBGET integrated database retrieval system