KEGG   Mus musculus (mouse): 19211Help
Entry
19211             CDS       T01002                                 

Gene name
Pten, 2310035O07Rik, A130070J02Rik, AI463227, B430203M17Rik, MMAC1, PTENbeta, TEP1
Definition
(RefSeq) phosphatase and tensin homolog
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00562  Inositol phosphate metabolism
mmu01100  Metabolic pathways
mmu01521  EGFR tyrosine kinase inhibitor resistance
mmu04068  FoxO signaling pathway
mmu04070  Phosphatidylinositol signaling system
mmu04071  Sphingolipid signaling pathway
mmu04115  p53 signaling pathway
mmu04140  Autophagy - animal
mmu04150  mTOR signaling pathway
mmu04151  PI3K-Akt signaling pathway
mmu04218  Cellular senescence
mmu04510  Focal adhesion
mmu04931  Insulin resistance
mmu05165  Human papillomavirus infection
mmu05166  Human T-cell leukemia virus 1 infection
mmu05200  Pathways in cancer
mmu05206  MicroRNAs in cancer
mmu05213  Endometrial cancer
mmu05214  Glioma
mmu05215  Prostate cancer
mmu05218  Melanoma
mmu05222  Small cell lung cancer
mmu05224  Breast cancer
mmu05225  Hepatocellular carcinoma
mmu05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    19211 (Pten)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    19211 (Pten)
   04070 Phosphatidylinositol signaling system
    19211 (Pten)
   04071 Sphingolipid signaling pathway
    19211 (Pten)
   04151 PI3K-Akt signaling pathway
    19211 (Pten)
   04150 mTOR signaling pathway
    19211 (Pten)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    19211 (Pten)
  09143 Cell growth and death
   04115 p53 signaling pathway
    19211 (Pten)
   04218 Cellular senescence
    19211 (Pten)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    19211 (Pten)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    19211 (Pten)
   05230 Central carbon metabolism in cancer
    19211 (Pten)
   05206 MicroRNAs in cancer
    19211 (Pten)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    19211 (Pten)
   05214 Glioma
    19211 (Pten)
   05218 Melanoma
    19211 (Pten)
   05215 Prostate cancer
    19211 (Pten)
   05213 Endometrial cancer
    19211 (Pten)
   05224 Breast cancer
    19211 (Pten)
   05222 Small cell lung cancer
    19211 (Pten)
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    19211 (Pten)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    19211 (Pten)
   05165 Human papillomavirus infection
    19211 (Pten)
  09176 Drug resistance: Antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    19211 (Pten)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mmu01009]
    19211 (Pten)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     19211 (Pten)
    3.1.3.48  protein-tyrosine-phosphatase
     19211 (Pten)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     19211 (Pten)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    19211 (Pten)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase Y_phosphatase3 PTPlike_phytase DUF3256
Motif
Other DBs
NCBI-GeneID: 19211
NCBI-ProteinID: NP_032986
MGI: 109583
Ensembl: ENSMUSG00000013663
Vega: OTTMUSG00000021203
UniProt: O08586 Q3UUT8
Position
19 C1; 19 28.14 cM
AA seq 403 aa AA seqDB search
MTAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSK
HKNHYKIYNLCAERHYDTAKFNCRVAQYPFEDHNPPQLELIKPFCEDLDQWLSEDDNHVA
AIHCKAGKGRTGVMICAYLLHRGKFLKAQEALDFYGEVRTRDKKGVTIPSQRRYVYYYSY
LLKNHLDYRPVALLFHKMMFETIPMFSGGTCNPQFVVCQLKVKIYSSNSGPTRREDKFMY
FEFPQPLPVCGDIKVEFFHKQNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEI
DSICSIERADNDKEYLVLTLTKNDLDKANKDKANRYFSPNFKVKLYFTKTVEEPSNPEAS
SSTSVTPDVSDNEPDHYRYSDTTDSDPENEPFDEDQHSQITKV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgacagccatcatcaaagagatcgttagcagaaacaaaaggagatatcaagaggatgga
ttcgacttagacttgacctatatttatccaaatattattgctatgggatttcctgcagaa
agacttgaaggtgtatacaggaacaatattgatgatgtagtaaggtttttggattcaaag
cataaaaaccattacaagatatacaatctatgtgctgagagacattatgacaccgccaaa
tttaactgcagagttgcacagtatccttttgaagaccataacccaccacagctagaactt
atcaaacccttctgtgaagatcttgaccaatggctaagtgaagatgacaatcatgttgca
gcaattcactgtaaagctggaaagggacggactggtgtaatgatttgtgcatatttattg
catcggggcaaatttttaaaggcacaagaggccctagatttttatggggaagtaaggacc
agagacaaaaagggagtcacaattcccagtcagaggcgctatgtatattattatagctac
ctgctaaaaaatcacctggattacagacccgtggcactgctgtttcacaagatgatgttt
gaaactattccaatgttcagtggcggaacttgcaatcctcagtttgtggtctgccagcta
aaggtgaagatatattcctccaattcaggacccacgcggcgggaggacaagttcatgtac
tttgagttccctcagccattgcctgtgtgtggtgatatcaaagtagagttcttccacaaa
cagaacaagatgctcaaaaaggacaaaatgtttcacttttgggtaaatacgttcttcata
ccaggaccagaggaaacctcagaaaaagtggaaaatggaagtctttgtgatcaggaaatc
gatagcatttgcagtatagagcgtgcagataatgacaaggagtatcttgtactcacccta
acaaaaaacgatcttgacaaagcaaacaaagacaaggccaaccgatacttctctccaaat
tttaaggtgaaactatactttacaaaaacagtagaggagccatcaaatccagaggctagc
agttcaacttctgtgactccagatgttagtgacaatgaacctgatcattatagatattct
gacaccactgactctgatccagagaatgaaccttttgatgaagatcagcattcacaaatt
acaaaagtctga

DBGET integrated database retrieval system