KEGG   Mus musculus (mouse): 19212
Entry
19212             CDS       T01002                                 

Gene name
Pter, AI790318, Mpr56, Mpr56-1
Definition
(RefSeq) phosphotriesterase related
  KO
K07048  phosphotriesterase-related protein
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PTE TatD_DNase
Other DBs
NCBI-GeneID: 19212
NCBI-ProteinID: NP_032987
MGI: 107372
Ensembl: ENSMUSG00000026730
Vega: OTTMUSG00000011123
UniProt: Q60866
Position
2; 2 A1
AA seq 349 aa
MSSLSGKVQTVLGLVEPSQLGRTLTHEHLTMTFDSFYCPPPPCHEVTSKEPIMMKNLFWI
QKNPYSHRENLQLNQEVGAIREELLYFKAKGGGALVENTTTGLSRDVHTLKWLAEQTGVH
IIAGAGFYVDATHSAATRAMSVEQLTDVLINEILHGADGTSIKCGVIGEIGCSWPLTDSE
RKILEATAHAQAQLGCPVIIHPGRNPGAPFQIIRILQEAGADISKTVMSHLDRTIFDKKE
LLEFAQLGCYLEYDLFGTELLNYQLSPDIDMPDDNKRIRRVHFLVDEGYEDRILMAHDIH
TKHRLMKYGGHGYSHILTNIVPKMLLRGLTERVLDKILIENPKQWLTFK
NT seq 1050 nt   +upstreamnt  +downstreamnt
atgtcttccttaagtgggaaagtacaaacagttctgggccttgtagaacccagccaactg
ggacgcaccctgacccacgagcatctgacaatgacctttgacagtttttactgcccacct
cctccatgccacgaagtcacctccaaggaacctatcatgatgaaaaatctattttggatt
cagaaaaacccctattcccatcgagagaaccttcagttgaatcaggaggtaggagccata
agagaagagctgttgtatttcaaggctaagggcggaggagccttggtggagaatacgaca
actgggctcagcagggacgtgcatacgctgaagtggctggcagagcagactggagtccac
atcatagctggagctgggttttatgttgatgcaactcactctgcagcaaccagagccatg
tcagtggagcagcttacagatgtccttattaatgaaattctccatggagctgatggcacc
agcatcaagtgtggagttattggagaaattggctgctcctggcctttgactgacagcgag
agaaagatacttgaggctacagctcacgcccaggctcagcttggctgtcctgtcatcatc
catcctggacggaacccaggtgcaccattccagataatccgtatactgcaagaagcagga
gcagacatctccaaaacagtcatgtcccaccttgacaggactatatttgataagaaagag
ctgctggagtttgctcaacttggctgctacttggaatacgatctctttggtacggaactc
cttaattaccagttgagcccagatattgatatgcctgatgataacaaaagaattagaagg
gtccattttctagtggatgagggctatgaagatcggattctcatggcacatgacatacac
acaaagcatcggttgatgaagtacggaggtcacggctactcacacatccttaccaacatt
gttcctaagatgctccttagaggtctgactgagagggtgcttgacaagatactcatagaa
aaccctaaacaatggctgacttttaaatag

DBGET integrated database retrieval system