KEGG   Mus musculus (mouse): 192120
Entry
192120            CDS       T01002                                 

Gene name
Bspry
Definition
(RefSeq) B-box and SPRY domain containing
Organism
mmu  Mus musculus (mouse)
SSDB
Motif
Pfam: PRY SPRY zf-B_box Trypan_PARP PrgH
Other DBs
NCBI-GeneID: 192120
NCBI-ProteinID: NP_619594
MGI: 2177191
Ensembl: ENSMUSG00000028392
Vega: OTTMUSG00000000309
UniProt: Q80YW5 B2RT02
Position
4; 4 B3
AA seq 486 aa
MSADVSGTESGSESGPEPEPGPEPGPESRPESRPKPGPGPEPRPESGPEPGPRSGLRRGP
KQGSERSQLCPEHFEPLSWFCLSERRPVCATCAGFGGRCHRHRIRRAEEHAEELRNKIVD
QCERLQLQSAGISKYMAEVLQGKNQKAVVMASAARDLIIQRLSLVRSLCESEEQRLLEQV
HGEEERAHQSILTQRAHWVDAVQKLDTLRTNMVDMITHLDDLQLIQREQEIFERAEEAEG
ILDPQDSEKLSFNEKCAWSPLLTQLWAASVLGSLSGVEEVLIDERTVSPLLHLSEDRRTL
TFIAKKSKVCSDEPERFDHWPNALAATAFQTGLHAWIVNVKHSCAYKVGVASDQLPRKGS
GNDCRLGHNAFSWVFSRYDQEFCFSHNGYHEPLPLLRCPAQLGMLLDLQAGELVFYEPAS
GTVLHIHRASFPQVLFPVFAVADQLISIVRGPLATVRLDSPPHHPCSIRRTTCQDTVGQN
VVVGVW
NT seq 1461 nt   +upstreamnt  +downstreamnt
atgtccgcggatgtctccgggacggagtccgggtccgagtccgggccggagccggagccg
ggaccggagcccggaccggagtcccgaccggagtcccggccgaagccgggaccgggaccg
gagcccagacccgagtccgggccggagccggggccgcgatccggactgaggaggggaccg
aagcaggggtccgagcggagccagttgtgccccgagcacttcgagcctctgagctggttc
tgcctctcggagcgacggccggtatgcgccacctgcgccgggtttggcggccgctgtcac
cggcaccgcatccgtcgagcggaggagcacgcggaggagctgagaaacaagattgtggac
cagtgtgagaggctgcagttacagagtgctggcatctccaagtatatggccgaggtcctg
caggggaagaaccagaaagcagtggtcatggctagtgcagcgagggacctgatcatccag
aggctgagtctggtgcggagcctgtgtgagagtgaggaacagcggttattggagcaggtg
cacggcgaagaggagcgggcccaccagagtatcctgactcagcgggcacactgggtggac
gcagtccagaaactggacaccctccgcaccaacatggtggacatgatcacccacctggat
gacctccagctgattcagagggaacaggagatttttgagagggccgaggaagcagagggc
attttggatccccaggattcggagaaattaagctttaatgagaagtgtgcttggagccca
ctactgacgcaactgtgggcagcatcggttctcgggtctctctcaggcgtggaggaggtg
ctgattgatgaaaggactgtcagccccttactgcatctgtctgaagatcgaaggaccctg
accttcattgccaagaagtctaaggtctgctcagatgaaccagagcgctttgaccactgg
cccaatgccctggctgccactgccttccagactgggctccatgcctggatagtgaacgtt
aaacacagttgtgcttataaagtgggtgtggcctcagatcagctgccccgaaagggctct
ggcaatgactgccgcctgggccacaatgccttctcctgggtcttctcccgctatgatcaa
gagttctgtttctcacacaatgggtatcatgagcctctgccactacttcggtgcccagca
cagctgggcatgctgctggacctgcaggcaggagagctggtcttctacgagcctgcctca
gggacggtgcttcatatccaccgtgcgtccttccctcaggtgctcttcccagtctttgct
gtggctgaccagctcatctccatcgttcgcggacctctggccacagtgagactagattca
cctccccatcacccttgcagcatacgaaggacaacctgccaggatactgttggccagaac
gtcgtcgtgggagtgtggtag

DBGET integrated database retrieval system