KEGG   Mus musculus (mouse): 19214Help
Entry
19214             CDS       T01002                                 

Gene name
Ptgdr, DP, PGD
Definition
(RefSeq) prostaglandin D receptor
  KO
K04332  prostaglandin D2 receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19214 (Ptgdr)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    19214 (Ptgdr)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    19214 (Ptgdr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 19214
NCBI-ProteinID: NP_032988
MGI: 102966
Ensembl: ENSMUSG00000071489
Vega: OTTMUSG00000036408
UniProt: P70263
Position
14 C1; 14 22.59 cM
AA seq 357 aa AA seqDB search
MNESYRCQTSTWVERGSSATMGAVLFGAGLLGNLLALVLLARSGLGSCRPGPLHPPPSVF
YVLVCGLTVTDLLGKCLISPMVLAAYAQNQSLKELLPASGNQLCETFAFLMSFFGLASTL
QLLAMAVECWLSLGHPFFYQRHVTLRRGVLVAPVVAAFCLAFCALPFAGFGKFVQYCPGT
WCFIQMIHKERSFSVIGFSVLYSSLMALLVLATVVCNLGAMYNLYDMHRRQRHYPHRCSR
DRAQSGSDYRHGSLHPLEELDHFVLLALMTVLFTMCSLPLIYRAYYGAFKLENKAEGDSE
DLQALRFLSVISIVDPWIFIIFRTSVFRMLFHKVFTRPLIYRNWSSHSQQSNVESTL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagtcctatcgctgtcagacatccacctgggtggaaaggggctcctcggcgacg
atgggcgctgtgctcttcggtgcggggcttctgggcaatcttctggcgctggtgctgctg
gcgcgctcgggactggggtcttgccggccagggccactacacccgccgccctcggtcttt
tatgtgctcgtgtgtggcttgacggtcaccgacttgctgggcaagtgtctgatcagcccg
atggtcctggctgcctacgcgcaaaaccagagcctaaaggaactgctgcctgcctcaggc
aatcagttatgcgaaacgttcgccttcctgatgtccttctttgggctagcctcgacctta
cagctgttggctatggcggtggagtgctggctgtctctgggacaccccttcttctaccaa
aggcacgtcaccttgcgccggggagtgctggtggcaccggtcgtggccgccttctgcttg
gctttctgtgcgctcccctttgctggttttgggaagttcgtgcagtactgtccaggcacc
tggtgtttcatccagatgatccacaaggagcgttcattttcggtaataggcttctctgtg
ctctactccagcctcatggcgctgctggtcctcgcaaccgtggtgtgcaacctgggtgcc
atgtacaacctctatgacatgcacaggcgccagaggcactatcctcaccgctgctccagg
gaccgcgcccagtcaggctcagactacaggcacgggtccctgcatcctttggaggagctg
gaccactttgtgctgctggctctcatgacagtgctcttcaccatgtgttccctgccttta
atttatcgtgcgtactatggagcctttaaacttgagaacaaagctgaaggagactcagaa
gacctccaagccttgcgtttcctgtctgtgatttccatagtggacccctggatcttcatc
atcttcaggacttcagtattccggatgttatttcacaaggttttcacaagacctctgatc
tacagaaactggagcagccattcccagcaaagtaacgtggaatccactttgtga

DBGET integrated database retrieval system