KEGG   Mus musculus (mouse): 19216Help
Entry
19216             CDS       T01002                                 

Gene name
Ptger1, EP1, Ptgerep1
Definition
(RefSeq) prostaglandin E receptor 1 (subtype EP1)
  KO
K04258  prostaglandin E receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    19216 (Ptger1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19216 (Ptger1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19216 (Ptger1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    19216 (Ptger1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    19216 (Ptger1)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    19216 (Ptger1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 19216
NCBI-ProteinID: NP_038669
MGI: 97793
Ensembl: ENSMUSG00000019464
Vega: OTTMUSG00000025957
UniProt: P35375 B2RS62
Position
8 C2; 8 40.22 cM
AA seq 405 aa AA seqDB search
MSPCGLNLSLADEAATCATPRLPNTSVVLPTGDNGTSPALPIFSMTLGAVSNVLALALLA
QVAGRMRRRRSAATFLLFVASLLAIDLAGHVIPGALVLRLYTAGRAPAGGACHFLGGCMV
FFGLCPLLLGCGMAVERCVGVTQPLIHAARVSVARARLALAVLAAMALAVALLPLVHVGR
YELQYPGTWCFISLGPRGGWRQALLAGLFAGLGLAALLAALVCNTLSGLALLRARWRRRR
SRRFRKTAGPDDRRRWGSRGPRLASASSASSITSATATLRSSRGGGSARRVHAHDVEMVG
QLVGIMVVSCICWSPLLVLVVLAIGGWNSNSLQRPLFLAVRLASWNQILDPWVYILLRQA
MLRQLLRLLPLRVSAKGGPTELGLTKSAWEASSLRSSRHSGFSHL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagcccctgcgggcttaacctgagcctagcggatgaggcagcaacgtgcgcaacaccc
aggctccccaatacatctgtggtgctgccaacaggcgataatggcacatcaccagcgctg
cctatcttctccatgacgctgggtgctgtgtccaacgtgctggcgctggcgctgctggcc
caggttgcaggccgaatgcggcggcgccgctcggctgccaccttcctgttgttcgtcgcc
agcctgcttgccatcgacctagcaggccatgtgatcccgggcgccctggtgcttcgcctg
tatactgcggggcgtgcgcctgctggaggggcgtgtcatttcctgggtggctgcatggtc
ttcttcggcctgtgcccacttttgcttggctgtggcatggccgtagagcgctgtgtgggt
gtcacgcagccactgatccacgcggcgcgcgtatctgtggcccgcgcacgcctggcacta
gccgtgctggctgccatggctttggcagtggcgctgctgccactggtacacgtgggtcgc
tacgagttacagtaccctggcacctggtgttttattagccttgggcctcgtggaggttgg
cgccaggcgttgcttgccggcctcttcgccggccttggcctggccgcgctccttgcggca
ttagtgtgcaatacgctcagcggcctggcgctcctccgtgcccgctggagacggcgtcgc
tctcgacgattccgaaagaccgcaggtcccgatgatcgccggcgctggggatctcgtgga
ccccgcttggcctccgcctcgtctgcctcatccatcacttcagccacagccaccctccgc
agctctcggggcggcggctccgcgcgcagggttcacgcacacgatgtggaaatggtgggc
cagctcgtgggcatcatggtggtgtcgtgcatctgctggagccccctgctggtgttggtg
gtgttggccatcgggggctggaactctaactccctgcagcggccactctttctggctgta
cgcctcgcatcgtggaaccagatcctggacccatgggtgtacatcctgctgcgccaggcc
atgctgcgccaactgcttcgcctcctacccctgagggtcagtgccaagggtggtccaacg
gagctgggcctaaccaagagtgcctgggaagccagttcactgcgtagttcccggcacagt
ggtttcagtcacctctga

DBGET integrated database retrieval system