KEGG   Mus musculus (mouse): 192166Help
Entry
192166            CDS       T01002                                 

Gene name
Sardh
Definition
(RefSeq) sarcosine dehydrogenase
  KO
K00314  sarcosine dehydrogenase [EC:1.5.8.3]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00260  Glycine, serine and threonine metabolism
mmu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    192166 (Sardh)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.8  With a flavin or flavoprotein as acceptor
    1.5.8.3  sarcosine dehydrogenase
     192166 (Sardh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO GCV_T FAO_M GCV_T_C Pyr_redox_2 SoxG ThiF
Motif
Other DBs
NCBI-GeneID: 192166
NCBI-ProteinID: NP_619606
MGI: 2183102
Ensembl: ENSMUSG00000009614
Vega: OTTMUSG00000012037
UniProt: Q99LB7 Q3TWI2
Position
2; 2 A3
AA seq 919 aa AA seqDB search
MASLSRVLRVAATCPRGRAAWNLGLQPLATEARPTTEKSVPYQRTLKEEAQGASVVPQGP
SQPLPSTANVVVIGGGSLGCQTLYHLAKLGVGGAVLLERERLTSGTTWHTAGLLWQLRPS
DVEVELLAHTRQVVSRDLEEETGLHTGWIQNGGLFIASNQQRLNEYKRLMSLGKAYGIES
HVLSPAETKSLYPLMNVDDLYGTLYVPQDGTMDPAGTCTTLTRAAVARGAQVIENCAVTG
IRVRTDDFGVRRVAAVETEHGSIQTPCVVNCAGVWASKVGRMAGVKVPLVAMHHAYVVTE
RIEGIQNMPNVRDHDASVYLRLQGDALSVGGYEANPIFWEEVSDKFAFGLFDLDWDVFTQ
HIEGAINRVPVLEKTGIKSTVCGPESFTPDHKPLMGEAPELRGFFLGCGFNSAGMMLGGG
CGQELAHWIVHGRPEKDMYSYDIRRFHHSLTDHTRWIRERSHESYAKNYSVVFPHDEPLA
GRNMRRDPLHEELLGQGCVFQERQGWERPGWFNPQETAQVLDYDYYGAYGNQAHKDYTYS
RLLGDEYTFDFPPHHHMIQKECLACRGAAAVFNMSYFGKFYLLGVDARKAADWLFSADVN
RPPGSTVYTCMLNQRGGTESDLTVSRLAPGTQASPLVPAFEGDCYYLAVGGAVAQHNWSH
INTVLQDQEFRCQLMDSSEDLGMLSIQGPASRDILQDVLDADLSNEAFPFSTHQLVRAAG
HLVRAIRLSFVGELGWELHVPRASCLPVYRAVMAAGARHGLVNAGYRAIDSLSIEKGYRH
WHADLRPDDSPLEAGLAFTCKLKTSVPFLGREALEKQRATGLRRRLICLTVEEEVPMFGL
EAIWRNGQVVGHVRRADFGFTVNKTIAYGYIRDPSGGPVSLDFVKNGEYALERMGVTYAA
QVHLKSPFDPDNKRVKGIY
NT seq 2760 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagccgggtcctacgtgtagctgccacctgtcctcgagggagagctgct
tggaatctggggctacaacccctagccacagaggccaggcccaccaccgagaagagtgtt
ccttatcagcggaccctgaaggaggaggcccaaggtgcctccgtggtgccccaaggacca
agccagcccctgcctagcacagccaatgttgtggtcatcggtgggggcagtttgggctgc
cagactctgtatcacttggctaagctgggtgtaggtggagccgtgctgctggagagagag
cgactgacctctgggaccacctggcacacagcaggcttactgtggcagctgcggcccagc
gatgtggaggtagagcttttggctcacacacggcaagtggtgagccgtgatctggaagag
gagactgggctgcatacaggctggatccagaatggtggcctcttcatcgcctctaaccag
caacgcctgaatgaatacaagaggctcatgtcgttgggcaaggcctatggtatagaatcc
cacgtgctgagcccagcagagaccaagagtctatatccgctgatgaacgtggacgacctc
tatgggaccctgtatgtgccacaggatggtaccatggaccccgctggcacctgtactacc
ctcaccagagcagcagtggctcgaggagctcaggtcattgaaaactgtgcggtgactggc
atccgtgtgcggacggacgactttggagtgcggcgggtggcagctgtggagacagagcat
ggctccatccagacaccctgtgtggtcaactgtgcaggagtgtgggcgagcaaggtgggc
cgcatggctggagtgaaggtcccgctggtggccatgcaccatgcttacgtcgtcactgag
cgcatcgaggggatccagaacatgcccaatgtccgggatcacgatgcttctgtctacctc
cgactgcagggggatgccttgtctgtgggtggctatgaggccaaccctatcttttgggag
gaggtgtcagacaaatttgcctttggcctctttgacctggactgggatgtgttcacccag
cacattgaaggcgccattaaccgtgtccctgtgttggagaagacggggatcaagtccact
gtctgtggtcctgaatccttcacacctgaccataagcccctgatgggggaggctcctgaa
ctccgtggcttcttccttggctgtggcttcaacagtgcaggcatgatgttgggtggtggc
tgtggacaagagctggcccattggattgtgcacgggcgcccagagaaggacatgtacagc
tatgacatcaggcgtttccatcactcgctcacggaccacacccgctggatccgagagcgc
agccatgagtcctatgccaagaactactcggttgtcttcccacacgatgagccactggca
ggacgcaacatgaggagagaccccctgcatgaggagctgcttggacaaggctgtgtgttt
caagagcgacagggatgggaacggccgggatggttcaacccccaggaaacagctcaggtc
cttgactacgactactacggggcctacggaaaccaggcacacaaggactacacctacagc
aggttgctaggcgatgagtacaccttcgacttcccaccccaccaccacatgatccagaag
gaatgtctggcctgcagaggggctgctgctgtgttcaacatgtcttactttgggaagttc
tacctgctcggggtggacgccaggaaggctgcagactggctcttctcagcagatgtcaac
cgacccccaggctcaacagtgtacacatgcatgctgaaccaacggggaggcactgagagc
gacctgactgttagccgattggctcctggcacccaggccagtcccctggtccctgccttt
gaaggggattgctactacctggccgtgggtggggctgtggcccaacacaactggtcccac
ataaacacggtgctacaggaccaggagttccggtgccagcttatggatagttctgaagat
ctgggcatgctcagtatccagggcccagccagccgtgacatcctgcaggatgtgcttgat
gctgacctgagcaacgaggccttccccttctccacccaccagctggtgagagccgccggg
cacctggtccgggccatcaggctgtcctttgtcggggagctgggatgggagctgcatgta
ccccgggcatcctgcttgccagtgtaccgggctgtgatggctgcaggtgcgaggcatggc
ctagtcaacgcaggctaccgtgccatcgactccctgagcatcgagaaaggctatagacac
tggcatgcagacctgaggcccgatgacagccccctggaggcaggattggccttcacctgc
aaactcaagacctcggtgcccttcctaggccgagaggccctggagaagcagcgtgccaca
ggtctccgccgacgcctgatatgcctcactgtggaagaggaggtgcctatgtttggcctg
gaggccatctggagaaacggccaagtggtgggccatgtccggagagctgactttggattt
actgtgaacaagaccatcgcctatggctacatccgagaccccagtggtggccctgtctct
ctggactttgtgaagaatggagagtatgccttggagagaatgggggtcacctatgctgcc
caggttcacctgaagtctccctttgaccctgacaacaagcgggtgaagggaatctattga

DBGET integrated database retrieval system