KEGG   Mus musculus (mouse): 19217Help
Entry
19217             CDS       T01002                                 

Gene name
Ptger2, EP2, Ptgerep2
Definition
(RefSeq) prostaglandin E receptor 2 (subtype EP2)
  KO
K04259  prostaglandin E receptor 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04024  cAMP signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04924  Renin secretion
mmu05163  Human cytomegalovirus infection
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    19217 (Ptger2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19217 (Ptger2)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    19217 (Ptger2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    19217 (Ptger2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    19217 (Ptger2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    19217 (Ptger2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:mmu04030]
    19217 (Ptger2)
G protein-coupled receptors [BR:mmu04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    19217 (Ptger2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx 7TM_GPCR_Srb SUR7
Motif
Other DBs
NCBI-GeneID: 19217
NCBI-ProteinID: NP_032990
MGI: 97794
Ensembl: ENSMUSG00000037759
Vega: OTTMUSG00000036411
UniProt: Q62053 Q543A9
Position
14 C1; 14 22.68 cM
AA seq 362 aa AA seqDB search
MDNFLNDSKLMEDCKSRQWLLSGESPAISSVMFSAGVLGNLIALALLARRWRGDTGCSAG
SRTSISLFHVLVTELVLTDLLGTCLISPVVLASYSRNQTLVALAPESHACTYFAFTMTFF
SLATMLMLFAMALERYLSIGYPYFYRRHLSRRGGLAVLPVIYGASLLFCSLPLLNYGEYV
QYCPGTWCFIRHGRTAYLQLYATMLLLLIVAVLACNISVILNLIRMHRRSRRSRCGLSGS
SLRGPGSRRRGERTSMAEETDHLILLAIMTITFAICSLPFTIFAYMDETSSLKEKWDLRA
LRFLSVNSIIDPWVFAILRPPVLRLMRSVLCCRTSLRTQEAQQTSCSTQSSASKQTDLCG
QL
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggacaattttcttaatgactccaagctaatggaggactgcaagagtcgtcagtggctc
ctttcgggggaaagcccagccatcagctcggtgatgttctcggccggggttctggggaat
ctcatcgcactggcactgttggcgcgccgctggcgtggggacaccgggtgtagcgccggc
agcaggacctctatctccttgtttcacgtgctggtaacggaattggtgctcactgacctg
ctgggaacctgcctcatcagcccggtggtgctggcttcatattcaagaaaccagaccctg
gtggccctggctcccgaaagtcacgcgtgtacctatttcgctttcactatgaccttcttt
agtctggccacgatgctcatgctcttcgctatggccctggaacgctacctctccatcggg
tacccttacttctacaggcgccacttatcgcgccgcgggggtctggcggtgctgcctgtc
atctatggggcctccttgctcttctgttccctgccgctgctcaactacggggagtacgtc
cagtactgtcctgggacatggtgctttatccggcacgggaggactgcataccttcagctg
tacgccacgatgctcctgctgcttatcgtggctgtgctcgcctgcaacatcagcgttatc
ctcaacctcattcgcatgcaccgtcggagcagaagaagccgctgcggattgtctggcagt
agcctaagaggccctggatctcgcaggagaggagagaggacttcgatggcagaggagacg
gaccacctcattctcctggccattatgaccatcaccttcgccatatgctccttgcctttc
acaatctttgcctacatggatgaaacctcttccctaaaggaaaagtgggacctccgagct
cttcggtttttatcagttaactctataattgacccttgggtctttgccatacttaggcca
ccggtcctgaggttaatgcgctcagtcctctgttgtcggacttcactgagaacacaagaa
gctcagcaaacatcctgttctacccagtccagtgccagtaaacagactgacctttgtgga
cagttgtga

DBGET integrated database retrieval system