KEGG   Mus musculus (house mouse): 192174
Entry
192174            CDS       T01002                                 
Symbol
Rwdd4a, Gm1942, Rwdd4
Name
(RefSeq) RWD domain containing 4A
Organism
mmu  Mus musculus (house mouse)
SSDB
Motif
Pfam: RWD
Other DBs
NCBI-GeneID: 192174
NCBI-ProteinID: NP_987103
MGI: 2681000
Ensembl: ENSMUSG00000031568
UniProt: Q9CPR1
Position
8:47986680..48005872
AA seq 188 aa
MGANEDQEMELEALRSIYEGDNSFRELSPVSFQYRIGEDGDPKAFLIEVSWTETYPQTAP
VISMNAFFNNTISSAVKQSILAKLQEAVEVNLGTAMTYTLFEYAKDHKEQFMENHHPGNS
ATPVANIISVETPTTAPSSKKKEKKEQLSKAQKRKLADKTDHKGELPRGWNWVDVVKHLS
KTGSKDDE
NT seq 567 nt   +upstreamnt  +downstreamnt
atgggtgccaacgaggaccaagagatggagctagaagctttacggtctatttatgaagga
gataacagtttccgggaattaagtccagtgtcatttcaatataggataggtgaagacggc
gatcccaaagccttcctgatagaggtttcctggacggagacatacccgcagacagctccg
gtcatatctatgaacgccttttttaacaacaccatctcctcggcagtgaagcagagcatc
ttagccaagctgcaggaagcagtggaagtgaatctcggcacggccatgacctacacgttg
ttcgagtacgctaaggaccataaagagcagttcatggagaaccaccatcctgggaattct
gcaacgcctgtagccaatatcatctcggttgaaactcccaccacagccccatcaagtaag
aaaaaagagaagaaagaacaactttccaaagctcagaaacgcaagctggcagataaaaca
gatcacaaaggggagctgcctcgcggctggaactgggttgacgtcgtgaagcatttaagc
aaaactggctctaaagatgatgagtag

DBGET integrated database retrieval system