KEGG   Mus musculus (mouse): 192176
Entry
192176            CDS       T01002                                 

Gene name
Flna, ABP-2, ABP-280, Di, Dilp2, F730004A14Rik, Fl, Fln1, GENA_379, fila, filamin-1
Definition
(RefSeq) filamin, alpha
  KO
K04437  filamin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04510  Focal adhesion
mmu05132  Salmonella infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    192176 (Flna)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    192176 (Flna)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    192176 (Flna)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    192176 (Flna)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    192176 (Flna)
   04147 Exosome [BR:mmu04147]
    192176 (Flna)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     192176 (Flna)
  Intermediate filaments
   Intermediate filament-binding proteins
    192176 (Flna)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   192176 (Flna)
SSDB
Motif
Pfam: Filamin Y_Y_Y CFSR Big_3_5
Other DBs
NCBI-GeneID: 192176
NCBI-ProteinID: NP_001277350
MGI: 95556
Ensembl: ENSMUSG00000031328
Vega: OTTMUSG00000016503
Position
X A7.3; X 37.89 cM
AA seq 1988 aa
MADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSV
EATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGV
AKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYT
PCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNA
KTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKS
PFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCK
VEPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQG
GNAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINIL
FADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICS
EAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQ
CYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKV
EYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVE
TRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFK
VPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDV
VDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG
VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTIL
IKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAA
GKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVT
ALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTI
KKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFY
VDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGT
CSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETD
LSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVI
SQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLED
GTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANIGSH
CDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQ
HVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPS
KAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSS
LQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGI
YLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGA
GALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGP
RLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFT
VDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPG
SPYRIMVP
NT seq 5967 nt   +upstreamnt  +downstreamnt
atggctgacatccgtgaggcaccccaggattttcacccagacagggtgaaggcacgtggg
cctggattggagaagactggtgtggctgtcaacaagccagcagagttcacagttgatgcc
aagcatgctgggaaggctcctcttcgagttcaagttcaggacaatgagggctgctctgtg
gaagcgacagtcaaggacaatggcaatggtacttacagctgttcttatgtgcccagaaag
ccagtgaagcacacagccatggtttcttggggaggtgtcagcatccccaacagtcctttc
cgggtgaatgtgggagctggcagccatccaaacaaagtcaaggtgtatggtccaggagtg
gccaagactgggctcaaggcccatgaacctacctactttactgtggattgtactgaagct
ggccagggagatgtcagcattggtatcaagtgtgcccctggagtagtgggccccactgag
gctgatattgactttgatatcatccgcaatgacaatgacaccttcactgtaaaatacaca
ccctgtggggctggcagctataccatcatggtcctttttgctgaccaggccacacccacc
agccccatcagagtcaaagtggagccttctcatgatgccagcaaggtgaaggctgagggt
cctggcctaaatcgcactggtgttgaacttggcaaacccacccatttcacagtcaatgct
aaaactgctgggaaaggcaagctggatgtccaattctcaggactggctaagggagatgca
gtacgggatgtggacatcattgaccaccatgataatacctacacagtcaagtacattcct
gtgcagcagggcccagtaggtgtcaatgtcacttatggaggagatcacatccccaagagt
ccattttcagtgggagtatctccaagcctggatctcagcaaaatcaaggtgtctggcctt
ggtgacaaagtggacgttggcaaagatcaagagttcacagtaaagtcaaagggtgcaggt
ggtcaaggcaaagtagcatccaagattgtgagtccctcaggtgcagcggtaccctgcaag
gtagagccaggcctgggagctgacaacagcgtggtacgttttgtgccccgtgaagagggg
ccctatgaggtggaagtgacctatgatggtgtgcctgtacctggcagtccctttccacta
gaagctgtggcccccaccaaacccagcaaggtgaaggcgtttggaccagggctacagggg
ggcaatgcaggctcccctgcccgcttcaccattgatacaaagggtgctggcactggtggc
ctgggcctgacagtggaaggcccctgtgaagcacagcttgagtgcctagacaacggggat
ggtacatgctctgtgtcttatgtacccactgagcctggggactacaacatcaacatcctt
tttgctgacacccacattcctggatccccattcaaggcccatgtggctccttgttttgat
gcatccaaggtgaagtgctcaggccctgggctggagcgggctactgctggtgaggtaggg
cagttccaagtggactgttcaagtgctggcagtgctgagttgacgattgagatctgctct
gaggcaggactgccagctgaagtatacattcaagaccatggtgatggcacacacaccatt
acctatattcctctctgtcctggggcttacactgttaccatcaagtatggcggccagcct
gtgcccaacttccccagcaagctacaggtggaacctgctgtagatacctcaggtgtacag
tgctatgggcctgggattgaaggtcaaggtgtcttccgagaggcaaccactgagttcagt
gtggatgcccgggctcttacacagactggagggccacatgtcaaggctcgagtggccaac
ccctcaggcaatctgacagatacctatgtgcaagactgtggggatggcacatacaaagtg
gaatacactccatatgaggaaggagtacactctgtggatgtgacttatgatggcagccct
gtgcccagcagccccttccaggtgcctgtaacagagggctgtgacccctcccgggtgcgt
gtccatggaccaggcatccaaagtggtaccaccaacaaacccaacaagttcacagtagaa
accaggggagctggcacaggtggcctgggcttggctgttgagggtccctcagaggccaag
atgtcttgtatggataataaagatggcagctgctcagtagaatacatcccctatgaagct
ggaacctatagccttaatgtcacttatggtggtcaccaagtgccaggtagtcccttcaag
gtccctgtacatgatgtgacagatgcatctaaagtcaagtgttctggacctggcctaagc
ccaggcatggtccgtgccaacctccctcagtcctttcaggtggacacaagcaaagctgga
gttgccccactgcaggtcaaagtgcaggggcccaaaggcctggtggagccagtggatgta
gtggacaatgctgatggtactcagactgtcaactatgtgcccagccgagaagggtcctat
agcatttctgtgctgtatggtgaagaagaagtgccacggagccccttcaaggtcaaggtg
ctgcctacacatgatgccagtaaggtgaaggccagtggacctggactcaacaccactggt
gtacctgctagcctgcctgtggagttcaccattgatgccaaggatgctggggagggtctg
ttggctgtccagattacggatcctgaaggcaagcccaagaagacacacattcaagataat
catgatggcacatacacggtggcttatgtgccagatgtgccaggccggtacacaatcctc
atcaagtatggtggtgatgagattcccttttccccgtaccgtgtccgggctgtgcccact
ggggatgccagcaagtgcacagtcacagtgtcaatcggaggtcacgggctaggtgctggc
attggccccaccatccagattggggaggagacggtgattactgtggacacaaaagcagca
ggcaaaggcaaagtgacttgtactgtgtgcacacctgatggctcagaggtagacgtggac
gtggtggagaatgaggatggcacctttgacatcttctacacagctccccaaccgggcaaa
tatgtcatctgtgtgcgcttcggtggcgagcatgtgcccaacagccccttccaagttaca
gctttggctggggaccaaccaacagtgcagaccccattaaggtctcagcagctggctcca
cagtataactatcctcagggtagccagcaaacctggattccagagaggcccatggtgggc
gttaatgggctggatgtgaccagcctgaggccctttgatcttgtcatccccttcactatc
aagaagggggagatcactggggaagttcgaatgccctcaggcaaggtggcccagccttcc
attactgataacaaagatggcactgttactgtacgttactcacccagtgaagctggcctg
catgaaatggacattcgctatgacaatatgcatatcccaggaagccctctgcagttctat
gttgattatgtcaactgtggccacatcactgcttatggtcctggccttacccatggagtg
gtcaacaaacctgccaccttcactgtcaacaccaaggatgcaggagaggggggcttgtct
ctggccattgagggtccatctaaagcagaaatcagttgcactgacaaccaggatggaaca
tgcagtgtctcttacctgcctgtactgcctggtgactatagcatcctagttaagtacaat
gatcaacacatcccaggcagtccctttactgccagagtaacaggtgacgattccatgcgt
atgtcccacctaaaggtgggttctgctgctgatatccccatcaatatctcagaaacagac
cttagcctactcacagccactgtggtgccaccttcgggtcgagaggaaccctgtctgctg
aaacgtttgcgaaatggccacgtggggatttccttcgtgcccaaggagacaggggagcac
ctggtacatgtgaagaagaatggccagcatgtggcaagcagtcccatcccagtagtgatc
agccagtcggagataggtgatgccagccgtgtgagggtctctggtcaaggtcttcatgaa
ggtcatacctttgagcctgcagagtttattattgacaccagagatgcaggctacggtggg
cttagtctgtccattgagggccctagcaaagtagacatcaacacagaggatctggaggat
ggcacatgcagggtcacctactgtcccacagagcctggaaactacattataaacatcaaa
tttgctgaccagcatgtgcctggcagtcccttttctgtgaaggtgacaggtgagggccgg
gtgaaagagagtatcacacgcaggcgacgtgccccttctgtggccaatattggcagtcat
tgtgacctcagcctgaagattcctgaaattagcatccaagatatgacagcccaggtgacc
agcccatcaggcaagacccatgaggcagagatcgtagaaggagagaaccatacttactgt
atccgatttgtgcctgctgagatgggaatgcatacagtcagtgtcaagtacaagggccag
catgtacctgggagccccttccagttcactgtggggcctctgggggaagggggtgctcac
aaggtccgtgctggaggccctggcctagagagggctgaagttggagtgccagcggagttc
ggcatttggactagggaagctggcgctggaggcctggccattgctgttgaaggccccagc
aaggctgagatctctttcgaggaccgaaaggatggctcctgtggtgtggcctacgtagtt
caggagccaggtgactatgaggtctcagtcaagttcaacgaggagcacatacctgatagc
cccttcgtggtgcctgtggcttctccgtctggtgacgcccgccgccttactgtttctagt
cttcaggagtcagggttaaaggtcaaccagccagcatcttttgcagtcagtctgaatgga
gccaagggggcaattgatgccaaggtgcacagcccctcaggagctctggaggagtgctat
gtcacagagattgaccaagataagtatgctgtgcgtttcatcccacgagagaatggcatc
tacttgattgatgtcaagttcaatggtactcacattcctggaagtcccttcaagatccga
gttggggagcctgggcatggaggggacccaggcttagtgtccgcctatggagcaggcctg
gaaggtggtgtcacagggagcccagcagagtttattgtgaacacaagcaatgcaggagct
ggtgccctttcggttaccattgatggcccctccaaggtgaagatggattgccaggagtgc
cccgagggctatcgtgtcacctatacccccatggcacctggcagctacctcatctccatc
aagtatggtggcccctatcacattggtggaagtccctttaaagccaaggtcacaggtcct
cgtcttgtaagcaaccacagcctccatgagacatcatctgtgtttgtggactctttgact
aaagttgccacggttccccagcatgcaacctcaggcccaggtcctgctgatgtcagcaag
gtagtagccaaaggcctggggctaagcaaggcttatgtaggccagaagagcaacttcaca
gtagattgcagcaaagcaggtaacaacatgctgctggtgggcgtgcatggcccaaggaca
ccctgtgaagagatcctggtgaaacacatgggcagccgcctctatagtgtctcttacctg
ctcaaggacaaaggggagtacacactggtggtcaagtggggtgatgagcatatcccaggc
agcccataccgcattatggtaccctga

KEGG   Mus musculus (mouse): 286940
Entry
286940            CDS       T01002                                 

Gene name
Flnb, AL024016, Fln-b
Definition
(RefSeq) filamin, beta
  KO
K04437  filamin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04510  Focal adhesion
mmu05132  Salmonella infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    286940 (Flnb)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    286940 (Flnb)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    286940 (Flnb)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    286940 (Flnb)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    286940 (Flnb)
   04147 Exosome [BR:mmu04147]
    286940 (Flnb)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     286940 (Flnb)
  Intermediate filaments
   Intermediate filament-binding proteins
    286940 (Flnb)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   286940 (Flnb)
SSDB
Motif
Pfam: Filamin CH Y_Y_Y Big_3_5 CFSR PapC_N CH_2
Other DBs
NCBI-GeneID: 286940
NCBI-ProteinID: NP_001074896
MGI: 2446089
Ensembl: ENSMUSG00000025278
Vega: OTTMUSG00000036302
UniProt: Q80X90
Position
14; 14 A1
AA seq 2602 aa
MPVTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVNKRIGNLQTDLSDGLRLIALLEVLSQK
RMHHKYHQRPTFRQMKLENVSVALEFLDHESIKLVSIDSKAIVDGNLKLILGLVWTLILH
YSISMPVWEDEGDDDAKKQTPKQRLLGWIQNKIPYLPITNFNQNWQDGKALGALVDSCAP
GLCPDWESWDPRKPVDNAREAMQQADDWLGVPQVITPEEIIHPDVDEHSVMTYLSQFPKA
KLKPGAPLKPKLNPKKARAYGRGIEPTGNMVKQPAKFTVDTISAGQGDVMVFVEDPEGNK
EEARVTPDSDKNKTYSVEYLPKVTGLHKVIVLFAGQHISKSPFEVNVDKAQGDASKVTAK
GPGLETTGNIANKPTYFDIYTAGAGVGDIGIEVEDPQGKNSVELLVEDRGNQVYRCVYKP
VQPGPHVVKVSFAGDAIPKSPFGVQIGEACNPNACRASGRGLQPKGVRIRETADFKVDTK
AAGSGELGVTVKGPKGLEELVKQKGFLDGVYSFEYYPSTPGKYSVAVTWGGHHIPKSPFE
VQVGPEAGMQKVRAWGPGLHGGIVGRSADFVVESIGSEVGTLGFAIEGPSQAKIEYDDQN
DGSCDVKYWPKEPGEYAVHIMCDDEDIKDSPYMAFIHPATGDYNPDLVQAYGPGLEKSGC
TINNPAEFIVDPKDAGSAPLKILAQDGEGQPIDIQMKSRMDGTYACSYTPLKAIKHTIAV
VWGGVNIPHSPYRVNIGQGSHPQKVKVFGPGVERSGLKANEPTHFTVDCTEAGEGDVSVG
IKCDARVLSDDEEDVDFDIIHNANDTFTVKYVPPAPGRYTIKVLFASQEIPASPFRVKVD
PSHDASKVKAEGPGLSKAGVENGKPTHFTVHTKGAGKAPLNVQFSSPLPGEAVKDLDIID
NYDYSHTVKYTPTQQGNMQVLVTYGGDPIPKSPFTVGVAAPLDLSKIKINGLENRVEVGK
DQEFAIDTNGAGGQGKLDVTILSPSRKVVPCLVAPVAGRECSTAKFIPREEGLFAVDVTY
DGHPVPGSPYTVEASLPPDPTKVKAHGPGLEGGLVGKPAEFTIDTKGAGTGGLGLTVEGP
CEAKIECSDNGDGTCSVSYLPTKPGEYFVNILFEEVHIPGSPFKADIEMPFDPSKVVASG
PGLEHGKVGEPGILCVDCSEAGPGTLGLEAVSDSGAKAEVSIQNNKDGTYAVTYVPLTAG
MYTLTMKYGGELVPHFPAWVKVEPAIDTSGIKAFGPGIEGKDVFREATTDFTVDSRPLTQ
VGGDHIKAQITNPSGASTECFVKDNADGTYQVEYTPFEKGFHVVEVTYDDVPIPNSPFKV
AVTEGCQPSRVHAQGPGLKEAFTNKSNVFTVVTRGAGIGGLGITVEGPSESKINCRDNKD
GSCSAEYIPFAPGDYDVNITYGGVHIPGSPFRVPSKDVVDPSKVKIAGPGLSSCVRACIP
QSFTVDSSKAGLAPLEVRVLGPRGLVEPVNVVDNGDGTHTVTYTPSQEGPYIVSVKYADE
EIPRSPFKVKVLPTYDASKVTASGPGLSAYGVPASLPVEFAIDARDAGEGLLAVQITDQE
GKPQRATVHDNKDGTYAVTYIPDKTGRYMIGVTYGGDNIPLSPYRIRATQTGDASKCLAT
GPGIAPTVKTGEEVGFVVDAKTAGKGKVTCVILTPDGTEAEADVIENEDGTYDIFYTAAK
PGTYVIYVRFGGVDIPNSPFTVMATDGEVTAMEEAPVNACPPGFRPWVTEEAYVPVSDMN
GLGFKPFDLVIPFAVRKGEITGTVHMPSGKKATPEIVDNKDGTVTVRYAPTEVGLHEMHI
KYRGSHIPESPLQFYVNYPNSGSVSAYGPGLVYGVANKTATFTIVTEDAGEGGLDLAIEG
PSKAEISCIDNKDGTCTVTYLPTLPGDYSILVKYNDKHIPGSPFTAKITDDNRRCSQVKL
GSAADFLLDISETDLSTLTASIKAPSGRDEPCLLKRLPNNHIGISFIPREVGEHLVSIKK
NGNHVANSPVSIMVVQSEIGDARRAKVYGQGLSEGRTFEMSDFIVDTRDAGYGGISLAVE
GPSKVDIQTEDLEDGTCKVSYFPTVPGVYIVSTKFADEHVPGSPFTVKISGEGRVRESIT
RTSRAPAVATVGSICDLNLKIPEINSSDMSAHVTSPSGHVTEAEIVPMGKNSHCVRFVPQ
EMGVHTVSVKYRGQHVTGSPFQFTVGPLGEGGAHKVRAGGPGLERGEAGIPAEFSIWTRE
AGAGGLSIAVEGPSKAEITFDDHKNGSCGVSYIAQEPGNYEVSIKFNDEHIPDSPYLVPV
IAPSDDARCLTVLSLQESGLKVNQPASFAIRLNGAKGKIDAKVHSPSGAVEECHVSELEP
DKYAVRFIPHENGIHTIDVKFNGSHVVGSPFKVRVGEPGQAGNPALVSAYGAGLETGTTG
IQSEFFINTTQAGPGTLSVTIEGPSKVKMDCQEIPEGYKVMYTPMAPGNYLIGVKYGGPN
HISRSPFKAKVTGQRLVSPGSANETSSILVESVTRSSTETCYSAIPKSSSDASKVTSKGA
GLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGKQQYNVTYVVKERGD
YVLAVKWGEEHIPGSPFHVTVP
NT seq 7809 nt   +upstreamnt  +downstreamnt
atgccggtgacggagaaagacctggcggaggacgcgccgtggaagaagattcagcagaac
acgttcacgcgctggtgcaacgagcacctcaagtgtgtgaataaacgcatcgggaacctg
cagaccgacctgagcgacgggctacggctcatcgcgctgctcgaggtgctcagccagaag
cgcatgcaccacaagtaccatcagcggcccaccttcagacagatgaagctggagaatgtg
tctgtggctctggagttcctagaccacgaaagcattaagctcgtgtccattgacagtaaa
gccatcgtggatgggaacctgaagctcatcttgggcctggtatggactttgatccttcac
tactccatctccatgcccgtatgggaagatgaaggggatgatgatgccaagaagcagaca
ccaaagcagaggctactgggatggattcagaacaagattccatacttgcccatcactaac
tttaaccagaactggcaagatggcaaagccttaggagccctggtagacagctgtgctcca
ggtctgtgcccagactgggaatcctgggacccacggaagccggtggataatgcccgagaa
gccatgcagcaggccgatgactggctgggcgtcccacaggtcatcactcctgaggagatt
attcacccggacgtggacgagcactctgtgatgacctacctgtctcagttccccaaagcc
aagctcaagccaggtgctcctcttaaacccaaactcaacccaaagaaagcccgagcctat
ggcagaggaatcgaacctactggaaacatggtgaagcagccagccaaattcacggtagat
accatcagcgctggacaaggagatgtgatggtgtttgttgaggacccagaaggaaacaag
gaagaggcacgtgtgaccccagacagtgacaagaacaagacatactctgtggagtatctg
cccaaagtcaccggcctgcataaagtcatcgtcctctttgcaggacagcacatttctaag
agcccatttgaagtgaatgttgacaaagcccaaggagatgccagcaaagtcactgcaaaa
ggcccagggctggaaactacagggaacattgccaacaagcctacctattttgacatctac
acagctggagctggcgtgggggacatcggcattgaggtggaggatccccagggcaagaac
agcgtggagctgctggtggaagacagaggaaaccaggtgtatagatgtgtctacaaacca
gtgcagcctggcccccatgtggtcaaggtctcctttgctggggatgccattcccaagagt
ccctttggtgtacaaattggggaagcctgcaacccaaatgcctgcagagccagcggccga
ggtctgcagcccaaaggtgtccggatccgggagactgcagactttaaggtggacaccaag
gctgctggaagcggagagcttggtgtaactgtgaagggccctaagggcctggaggagctg
gtcaaacaaaagggctttctggatggggtctactcatttgagtactaccccagcacacca
gggaaatacagcgttgcagttacctggggggggcaccacattcccaagagcccctttgaa
gttcaagttggccctgaagcaggcatgcagaaagtccgtgcatggggccctggactccac
ggcggcattgttggtcggtcagcagattttgtggtggaatccattggttctgaggttgga
actctgggatttgccattgaaggcccttcccaagcaaagatcgagtatgatgatcagaac
gatggctcgtgtgatgtcaaatactggcccaaggagcctggagaatacgccgttcacatc
atgtgcgacgacgaagacatcaaggacagcccatacatggctttcatccaccctgccaca
ggagactacaacccagatctagtccaagcctatgggccgggtttggagaaatctggttgt
actatcaacaacccagcagagttcattgtggatcctaaggatgccgggagtgctccctta
aagatactggcgcaggatggggaaggccagcccattgacatccagatgaagagtcggatg
gacggcacttatgcttgctcatataccccacttaaagccatcaagcacaccatcgctgtg
gtctggggaggtgtgaacataccacacagcccctacagggtcaacattgggcaaggtagc
catccccaaaaggtcaaagtgtttggcccaggcgtggagaggagtggtctgaaggcaaat
gagcctactcactttacagtggattgcacggaggccggggaaggtgatgtcagtgttggt
atcaagtgcgatgcccgagttttaagtgacgatgaggaagatgtcgattttgacattatt
cacaatgccaatgacacattcactgtcaaatacgtacctcctgcccctgggcggtatacc
atcaaagttctctttgcatctcaggaaatccccgccagccctttcagagtcaaagttgac
ccttcccatgacgccagcaaggtgaaggcagaaggccccgggttgagtaaagcaggcgtg
gaaaatgggaagccaacccacttcactgttcacaccaagggagccggaaaagctccgctc
aacgtgcagttcagcagcccccttcctggggaggcagtgaaggacttggatatcattgat
aattatgactactcacatactgttaaatacaccccaacccagcagggcaacatgcaggtt
ctagtgacttatggtggcgatcccattcctaaaagtcctttcactgtgggcgttgctgcg
ccactggatctgagcaagataaaaattaatggactggaaaacagagttgaggttggaaag
gaccaggaatttgccattgacaccaacggggcaggaggccaggggaagctggatgtgacc
atcctgagcccttctcggaaggtggtgccatgcttggtagcaccagtggctggcagggaa
tgcagcacagccaaattcatccctcgggaggaggggctgtttgctgtagatgtgacctat
gatggacacccagtgcccgggagcccctatactgtggaggcctcactaccaccagatccc
accaaggtgaaggcccacggtcctggccttgaaggaggtcttgtaggcaagcccgctgag
ttcaccattgacactaaaggagctggaactggaggtttgggcctaactgtggaaggtcca
tgtgaggccaaaatcgaatgctcggataacggtgacgggacctgctccgtctcctacctt
cccacaaaacccggagaatactttgtcaacattctctttgaagaagtccacattcctgga
tctcccttcaaagccgacattgaaatgccgtttgacccctctaaggttgtagcgtcagga
ccaggacttgaacacggaaaagtgggtgaacccggaatcctttgcgttgattgttcagaa
gcagggcctgggactctgggccttgaagccgtctcagactcaggggcgaaagctgaagtg
tccatccagaacaataaagatggcacctacgctgtgacctatgtgcctctgacagctggc
atgtacacactgaccatgaagtatggtggtgagcttgtaccacactttcctgcctgggtc
aaggtggagccagccatagacactagtgggatcaaagcctttgggccaggaatcgaaggc
aaggacgtgtttcgggaggccacaacggacttcacggttgactcgaggccccttacccag
gttggaggtgaccatatcaaagctcaaattaccaacccctcgggggcctccaccgagtgc
tttgtcaaggacaatgctgatgggacctatcaggtcgaatacacgccctttgagaaaggt
ttccatgtagtggaggtgacatacgatgatgtgcccatcccaaatagcccattcaaagtg
gctgtcactgaaggctgccagccatctcgggtccatgcgcaaggccctggactgaaagag
gcgtttaccaacaaatctaatgtcttcacagtggtaaccaggggagcagggatcggtggg
cttggcataactgtggaggggccgtcggagtcaaagataaactgcagagacaacaaggat
ggcagctgcagtgctgagtacattcctttcgctccaggggattatgacgtcaatatcacg
tacggaggcgtccacatccctggcagccccttcagagttccttcaaaagatgttgtggat
cccagcaaggtcaagattgctggccccggtctgagctcctgtgtccgagcatgcatcccg
cagtccttcacagtggacagcagcaaggctggcctagctcccctggaagtgagggtcctg
ggcccaagaggcctcgtggagccggtgaatgtggtagataatggggacggcacccacaca
gtgacctacacgccatctcaggaggggccctacattgtttccgtcaaatatgctgatgaa
gagatcccccgaagtccctttaaggtcaaggttcttcccacatacgatgcaagcaaagtg
acagcctctgggcctggcctcagcgcctatggggtacccgccagcctacctgtggagttc
gccattgatgccagagatgctggcgaaggcctgcttgctgtccagatcacggaccaggag
ggaaagcctcaaagagctactgtccacgacaacaaagatggcacatatgccgttacctat
atccctgataagaccggacgctatatgattggagtcacctatggtggagacaacattcca
ctttctccttaccgtatccgggccacacagacaggcgatgccagcaagtgcttggccaca
ggtcctggtattgcccccactgtgaaaactggcgaggaggtgggctttgtagtggacgct
aagactgcagggaaggggaaagtaacctgcgtgattctgaccccagatggcaccgaggct
gaggctgacgtcattgaaaatgaagatggcacctatgacattttctacactgctgccaag
ccaggcacctatgttatctatgtgcgctttggtggcgttgatattcccaatagccccttc
acagtcatggccaccgatggggaagtcacagccatggaggaggcaccggtaaatgcatgt
ccccctggattcaggccctgggttacagaagaggcctatgtccctgtgagtgacatgaac
gggctaggcttcaagccctttgacttggtgattccatttgccgtcaggaaaggagaaatt
acaggcacggtgcatatgccttctgggaagaaggctacacctgagattgtggacaacaag
gacggcacggtcactgtgagatacgcgcccactgaagtcggcctccacgagatgcacatc
aagtacaggggcagccacatcccggagagccccctgcagttctacgtgaactaccccaac
agtgggagtgtgtctgcttatggtccaggccttgtgtatggagtagccaacaaaactgcc
accttcaccattgtcacagaggatgcgggagaaggtggtctggacttggctattgaagga
ccctcgaaagcagagatcagctgcattgacaacaaagacgggacatgtacagtgacctac
ctacccaccttgccaggggactacagcattctggtcaagtacaatgacaaacatattcct
ggcagccccttcactgccaagatcacagatgataacagacgctgctcccaagtgaagctg
ggctcagctgctgacttccttctggacatcagtgagacagaccttagcacactgacagcc
agtatcaaggccccatctggacgtgacgagccctgtctgctaaagaggctacccaacaac
cacattggcatttccttcatcccccgagaagtgggtgagcatctagtcagcatcaagaaa
aacggtaaccacgtggccaacagccctgtgtccattatggtggtccagtctgaaattggt
gatgcacgccgagccaaagtctatggccaaggcctgtcagaaggccggacttttgagatg
tcagacttcatcgtggacacaagagatgcaggctatggtggcatatccttggcagtagaa
ggacccagcaaggtggacatccaaacagaggacctggaggacggcacctgcaaggtgtcc
tacttccccactgtgcccggggtctatatcgtctccaccaaatttgctgacgagcatgtg
cctggaagcccattcactgtgaagatcagtggcgagggaagagtcagagagagcatcacc
cggaccagccgggctccggctgtggccacggttggcagtatctgtgacctgaacctgaag
atcccggagatcaacagcagtgacatgtctgcccatgtcaccagcccctctggccatgtc
actgaggcagagattgtgcccatgggaaagaactctcactgtgtcagatttgtgccccag
gagatgggcgttcacactgtcagcgtaaagtaccgcggacagcacgtaacaggaagcccg
ttccagttcaccgtggggccccttggcgaagggggtgcccacaaggtccgggcaggaggc
cctggcctggagaggggagaagcaggcatcccagctgagttcagcatctggacccgggaa
gcaggtgctggcggcctctccattgctgttgagggccctagtaaggccgagatcacattc
gatgaccataaaaatgggtcatgcggtgtgtcttatattgcccaagagcctggtaactac
gaggtgtctatcaagttcaacgacgagcacatcccggacagcccttacctggtgcccgtc
atcgcgccctcagacgacgctcgctgcctcactgttctgagccttcaggaatcaggatta
aaagttaaccagccagcgtcctttgctataaggttgaatggtgcgaaagggaagattgat
gcaaaggtgcacagcccctcaggagccgtggaggaatgccacgtgtctgaactggagcca
gataagtatgccgttcgcttcatcccgcatgagaatggcatccacacgatcgatgtcaag
tttaacgggagccacgtggtcgggagccctttcaaagtacgtgtaggagagcctggccag
gcaggcaatcctgctctagtgtcagcctacggtgctgggcttgagacgggcaccacaggt
atccaatcagaattcttcatcaataccactcaggcaggcccagggacattatctgtcacc
attgaaggaccatccaaggtcaaaatggattgccaggaaatcccagaggggtacaaagtc
atgtacactcccatggctcctggaaattacctgattggtgtcaaatatggcgggcccaac
cacatctcgaggagtccattcaaggccaaggtgacaggccaacgtctggtcagcccaggc
tcagccaacgagacctcctccatcttggtggagtccgtaaccagatcctcaacggaaacg
tgctatagcgccattcccaagtcgtcctccgatgccagcaaagtgacctccaagggcgca
ggcctgtcaaaggcttttgtgggccagaagagttctttcctggtggactgcagcaaagct
gggtccaacatgctgttgattggggtccatgggcccaccaccccctgtgaagaggtctcc
atgaagcatgtgggcaagcaacagtacaacgtcacctacgtcgtcaaggagaggggcgat
tacgttctggctgtgaagtggggggaagagcacatccccggtagcccctttcatgtcacc
gtgccttaa

KEGG   Mus musculus (mouse): 68794
Entry
68794             CDS       T01002                                 

Gene name
Flnc, 1110055E19Rik, ABP-280, ABPL, Fl, Fln2
Definition
(RefSeq) filamin C, gamma
  KO
K04437  filamin
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04510  Focal adhesion
mmu05132  Salmonella infection
mmu05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    68794 (Flnc)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    68794 (Flnc)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    68794 (Flnc)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    68794 (Flnc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:mmu04812]
    68794 (Flnc)
   04147 Exosome [BR:mmu04147]
    68794 (Flnc)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     68794 (Flnc)
  Intermediate filaments
   Intermediate filament-binding proteins
    68794 (Flnc)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   68794 (Flnc)
SSDB
Motif
Pfam: Filamin CH Big_3_5 YtkA CFSR Invasin_D3
Other DBs
NCBI-GeneID: 68794
NCBI-ProteinID: NP_001074654
MGI: 95557
Ensembl: ENSMUSG00000068699
Vega: OTTMUSG00000022425
UniProt: Q8VHX6
Position
6 A3.3; 6 12.36 cM
AA seq 2726 aa
MMNNSNYSDASGLGLVDEADEMPSTEKDLAEDAPWKKIQQNTFTRWCNEHLKCVGKRLTD
LQRDLSDGLRLIALLEVLSQKRMYRKFHPRPNFRQMKLENVSVALEFLEREHIKLVSIDS
KAIVDGNLKLILGLIWTLILHYSISMPMWEDEDDEDARKQTPKQRLLGWIQNKVPQLPIT
NFNRDWQDGKALGALVDNCAPGLCPDWEAWDPNQPVQNAREAMQQADDWLGVPQVIAPEE
IVDPNVDEHSVMTYLSQFPKAKLKPGAPVRSKQLNPKKAIAYGPGIEPQGNTVLQPAHFT
VQTVDAGVGEVLVYIEDPEGHTEEAKVVPNNDKDRTYAVSYVPKVAGLHKVTVLFAGQNI
ERSPFEVNVGMALGDANKVSARGPGLEPVGNVANKPTYFDIYTAGAGTGDVAVVIVDPQG
RRDTVEVALEDKGDNTFRCTYRPVMEGPHTVHVAFAGAPITRSPFPVHVAEACNPNACRA
SGRGLQPKGVRVKEVADFKVFTKGAGSGELKVTVKGPKGTEEPVKVREAGDGVFECEYYP
VVPGKYVVTITWGGYAIPRSPFEVQVSPEAGAQKVRAWGPGLETGQVGKSADFVVEAIGT
EVGTLGFSIEGPSQAKIECDDKGDGSCDVRYWPTEPGEYAVHVICDDEDIRDSPFIAHIQ
PAPPDCFPDKVKAFGPGLEPTGCIVDRPAEFTIDARAAGKGDLKLYAQDADGCPIDIKVI
PNGDGTFRCSYVPTKPIKHTIIVSWGGVNVPKSPFRVNVGEGSHPERVKVYGPGVEKTGL
KANEPTYFTVDCSEAGQGDVSIGIKCAPGVVGPVEADIDFDIIKNDNDTFTVKYTPPGAG
HYTIMVLFANQEIPASPFHIKVDPSHDASKVKAEGPGLSRTGVEVGKPTHFTVLTKGAGK
AKLDVHFAGAAKGEAVRDFEIIDNHDYSYTVKYTAVQQGNMAVTVTYGGDPVPKSPFVVN
VAPPLDLSKVKVQGLNSKVAVGQEQAFSVNTRGAGGQGQLDVRMTSPSRRPIPCKLEPGG
GAEAQAVRYMPPEEGPYKVDITYDGHPVPGSPFAVEGVLPPDPSKVCAYGPGLKGGLVGT
PAPFSIDTKGAGTGGLGLTVEGPCEAKIECQDNGDGSCAVSYLPTEPGEYTINILFAEAH
IPGSPFKATIQPVFDPSKVRASGPGLERGKAGEAATFTVDCSEAGEAELTIEILSDAGVK
AEVLIQNNADGTYHITYSPAFPGTYTITIKYGGHPIPKFPTRVHVQPAVDTSGIKVSGPG
VEPHGVLREVTTEFTVDARSLTATGGNHVTARVLNPSGAKTDTYVTDNGDGTYRVQYTAY
EEGVHLVEVLYDEVAVPKSPFRVGVTEGCDPTRVRAFGPGLEGGLVNKANRFTVETRGAG
TGGLGLAIEGPSEAKMSCKDNKDGSCTVEYIPFTPGDYDVNITFGGQPIPGSPFRVPVKD
VVDPGKVKCSGPGLGTGVRARVPQTFTVDCSQAGRAPLQVAVLGPTGVAEPVEVRDNGDG
THTVHYTPATDGPYTVAVKYADQEVPRSPFKIKVLPSHDASKVRASGPGLNASGIPASLP
VEFTIDARDAGQGLLTVQILDPEGKPKKANIRDNGDGTYTVSYLPDMSGRYTITIKYGGD
EIPYSPFRIHALPTGDASKCLVTVSIGGHGLGACLGPRIQIGEETVITVDAKAAGKGKVT
CTVSTPDGAELDVDVVENHDGTFDIYYTAPEPGKYVITIRFGGEHIPNSPFHVLACDPLP
HVEEPAEMLQMRQPYAPLRPGTCPTHWATEEPVVPVEPLESMLRPFNLVIPFTVQKGELT
GEVRMPSGKTARPNITDNKDGTITVRYAPTEKGLHQMGIKYDGNHIPGSPLQFYVDAINS
RHVSAYGPGLSHGMVNKPATFTIVTKDAGEGGLSLAVEGPSKAEITCKDNKDGTCTVSYL
PTAPGDYSIIVRFDDKHIPGSPFTAKITGDDSMRTSQLNVGTSTDVSLKITEGDLSQLTA
SIRAPSGNEEPCLLKRLPNRHIGISFTPKEVGEHVVSVRKSGKHVTNSPFKILVGPSEIG
DASKVRVWGKGLSEGQTFQVAEFIVDTRNAGYGGLGLSIEGPSKVDINCEDMEDGTCKVT
YCPTEPGTYIINIKFADKHVPGSPFTVKVTGEGRMKESITRRRQAPSIATIGSTCDLNLK
IPGNWFQMVSAQERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFP
AVFGDFLGRERLGSFGSITRQQEGEASSQDMTAQVTSPSGKTEAAEIVEGEDSAYSVRFV
PQEMGPHTVTVKYRGQHVPGSPFQFTVGPLGEGGAHKVRAGGTGLERGVAGVPAEFSIWT
REAGAGGLSIAVEGPSKAEIAFEDRKDGSCGVSYVVQEPGDYEVSIKFNDEHIPDSPFVV
PVASLSDDARRLTVTSLQETGLKVNQPASFAVQLNGARGVIDARVHTPSGAVEECYVSEL
DSDKHTIRFIPHENGVHSIDVKFNGAHIPGSPFKIRVGEQSQAGDPGLVSAYGPGLEGGT
TGVSSEFIVNTQNAGSGALSVTIDGPSKVQLDCRECPEGHVVTYTPMAPGNYLIAIKYGG
PQHIVGSPFKAKVTGPRLSGGHSLHETSTVLVETVTKSSSSRGASYSSIPKFSSDASKVV
TRGPGLSQAFVGQKNSFTVDCSKAGTNMMMVGVHGPKTPCEEVYVKHMGNRVYNVTYTVK
EKGDYILIVKWGDESVPGSPFKVNVP
NT seq 8181 nt   +upstreamnt  +downstreamnt
atgatgaacaacagcaactattcggacgcctccggcctcggcctggttgacgaggcggac
gagatgccgtccacggagaaggacctagcggaggacgcaccgtggaagaagatccagcag
aacacattcacgcggtggtgcaacgagcatctcaagtgtgtgggcaagcgcctgaccgac
ctgcagcgagacctcagcgacgggctgcgcctcatcgcgctgctcgaagtgctcagccag
aagcgcatgtaccgcaagttccacccgcgccccaacttccgccaaatgaagctggaaaat
gtgtctgtggccctggagttcctggagcgggaacacatcaagctcgtgtccatcgacagc
aaggctattgtggatggaaacctgaagctgatcctaggcctgatctggacgctgatcctt
cactactccatttccatgcccatgtgggaggatgaagatgatgaggatgcccgcaaacag
acacccaagcagcgactgcttggctggatccagaacaaagtgccccagctgcccatcacc
aactttaaccgagactggcaggacggcaaggctctgggtgccctggttgacaactgtgcc
cctggtctctgccctgattgggaagcctgggaccccaaccagcccgtgcagaatgccaga
gaggccatgcagcaagctgatgactggctcggggtgccccaggtgattgctcctgaagaa
atcgtggatcccaatgtggatgaacactctgtcatgacctacctgtcccagtttcccaag
gccaagctcaaacccggtgcccctgttcgctctaagcagctgaatcctaagaaagccatt
gcctatgggcctggcattgagccccaggggaacactgtgctgcagcctgcccacttcacc
gtgcagacagtagatgctggtgtaggggaggtgctggtctacattgaggaccccgaggga
cacacggaggaggccaaagtggttcccaacaatgacaaagaccgcacctatgccgtctcc
tatgtgcccaaggttgctgggttacacaaggtgaccgtgctctttgctggccagaacatc
gagcgtagtccctttgaggtgaatgtgggcatggctctcggggatgccaacaaggtatca
gcccgtggccctggtctggaacctgtgggtaacgtggccaacaaacccacctactttgac
atctatactgccggggctggcactggtgatgttgctgtggtgatcgtggacccacaggga
cgtcgggatacagtcgaggtggccctggaggacaagggtgacaacacgttccgctgcacg
tacaggcccgtgatggaggggccacacaccgtgcatgtggcctttgctggtgcacccatc
acccggagtcctttccctgtccatgtggcagaagcctgtaaccccaacgcctgcagagcc
tctgggcggggcctgcagcccaaaggtgtgcgtgtgaaagaggtggctgacttcaaggtg
ttcaccaagggtgctggcagcggggaactcaaggtcaccgtcaaaggtccaaagggcaca
gaggagccagtgaaagttcgggaggctggagatggggtgttcgagtgcgagtactaccca
gtggtacctgggaagtatgtggtgaccatcacctggggtggctatgccattccccgcagt
ccttttgaggttcaggtgagcccagaggccggagcccagaaagtgcgggcatggggtcct
gggttggagactggccaggtgggcaagtcggctgacttcgtggtggaagccatcggtaca
gaagtgggaacgctgggcttctccatcgaggggccctcacaagccaagattgaatgtgat
gacaaaggtgacggctcctgtgacgtgcggtactggcccacggagcctggggagtatgct
gtgcatgtcatctgcgatgatgaagacatccgggactcgcctttcatcgcccacatccag
ccagccccaccagactgcttcccagacaaggtgaaagcatttggacctggcctggagccc
actggctgcatagtggacaggcctgccgagttcaccattgatgcccgtgctgctggcaag
ggagatttgaagctctatgcccaggatgcagatggctgccccatcgacatcaaggtgatc
cccaacggtgacggtaccttccgctgctcctacgtgcctaccaaacccatcaagcacact
atcatcgtctcctggggaggtgtcaacgtgcctaagagccccttcagggtgaatgtggga
gaaggcagccatcctgagcgggtgaaggtatatggccctggagtagagaagacaggcctt
aaagccaatgaacccacctatttcacagtggactgcagtgaagccgggcaaggtgatgtg
agtattggcatcaagtgtgctccaggcgtggtggggcctgtggaagctgacatcgacttt
gacatcatcaagaatgacaacgataccttcacagtcaagtacacaccccccggggccggc
cactacacgatcatggtgttgtttgccaaccaggagatccctgccagtcccttccacatc
aaggtggacccatcccatgacgctagcaaggtcaaggctgagggtcctgggctgagccgc
acaggtgtggaagtcggaaagccgactcactttaccgtgctgaccaagggagctggcaag
gctaagctggacgtgcactttgctggggcagccaagggcgaggctgtgcgggactttgaa
atcattgacaaccatgactattcatacactgtcaagtacacagctgtgcagcagggcaac
atggcagtaacagtgacctacggtggggaccctgtccccaaaagtccctttgtggtgaat
gtggcacccccactggacctcagcaaagtcaaagttcaaggcctcaacagcaaggtagct
gtgggacaggaacaggcgttctcggtgaacaccagaggggctggtggtcagggacaactc
gatgtgcggatgacctcaccctcccgacggcctatcccctgcaagctggagcctgggggt
ggagcagaagcccaggctgtccgctacatgccccctgaagagggaccttacaaggtggac
atcacctacgatggtcacccagtgcctggcagcccctttgctgtggaaggtgtcctgccc
cctgacccctctaaggtctgcgcgtatggccctggtctcaagggcgggcttgtaggcacc
ccggcaccattctccattgacaccaagggggccggcacaggaggcctggggctgactgtc
gagggcccctgcgaagccaagatcgagtgccaagacaatggtgacggatcttgtgcagtc
agctacctgcccacggagccaggcgagtacaccatcaatatcctgtttgctgaagcccac
atccctggctcgcccttcaaggccaccatccagcctgtgttcgacccaagcaaggtgagg
gccagtgggccaggcctggagcgtggcaaggctggagaggcagccaccttcaccgtggac
tgctcagaagcgggtgaggccgagctgaccatcgagatcctgtcggacgctggtgtcaaa
gcggaggtgctgatccaaaacaacgcggacggcacctaccacatcacctacagccctgcc
ttccccggcacctacaccatcaccatcaagtatggcggccaccccatacccaagttcccc
acccgtgtccacgtgcagcctgcagttgataccagtggcatcaaggtctctgggcctggt
gtggagccacatggtgtcctgcgggaggtgaccaccgagtttactgtggatgcgagatct
ctaacagctacaggcggcaaccatgtgacagctcgtgtcctcaacccctccggtgctaag
acagatacctatgtgacagacaacggggatggcacctaccgggtgcagtacactgcctat
gaagagggtgtgcatttggtagaggtgctgtatgacgaagtagctgtgcccaagagcccc
ttccgagtgggtgtgactgagggctgtgaccccacccgagtccgggccttcgggccaggt
ctggaaggtggcttggtgaacaaggccaaccgcttcactgtggaaaccaggggtgctggc
acaggaggccttggcctagccattgagggcccctcagaagctaagatgtcctgcaaggac
aacaaggacggaagctgcaccgtggagtacatcccctttacccctggagactatgatgtc
aacatcacctttgggggacagcccattccaggaagcccattccgagttcctgtgaaggat
gtggtagaccctgggaaggtgaagtgctcagggccagggctagggaccggcgtcagggct
cgagtacctcagaccttcacagtggactgcagtcaagctggccgggcccctctgcaggtg
gccgtgctgggccccacaggtgtggctgagcctgtggaggtgcgtgacaatggcgatggt
acccacactgtccactacacacctgccactgatggtccctatactgtagctgtcaagtat
gctgaccaggaggtgccacgaagccctttcaagatcaaagtgcttccatcccatgatgcc
agcaaagtgcgggccagtggccctggcctcaatgcctcgggcatccctgccagcctgccc
gtggagttcaccattgatgctcgtgatgctgggcaggggcttcttaccgtgcagatcctg
gatcccgagggtaaacccaagaaggccaacatccgagacaatggggatggcacatatact
gtgtcctacctgcccgacatgagtggtcggtacaccatcaccatcaagtacggcggcgat
gagatcccttactcgcccttccgcatccatgccctgcctacaggggatgccagcaagtgc
cttgttacagtgtccattggaggccatggactgggtgcctgcctgggtcccagaatccag
atcggagaggagactgtgatcacagtggacgccaaggcagcaggcaaggggaaggtgacc
tgcacagtatccacacccgatggggcagagctcgatgtggacgtggtcgagaaccatgat
ggcaccttcgacatctactacacagctcccgagccgggcaaatatgtcatcaccatccgc
tttgggggcgaacacatccccaacagccctttccacgtgctggcctgtgacccgctgcct
cacgtggaggagcccgcggaaatgctgcagatgcgccagccctatgcccctcttcggcct
ggcacctgccccacgcactgggccacagaggagcccgtggtgcctgtggagcctctggaa
tccatgctgaggcctttcaacttggtcatccccttcactgtgcagaaaggggagctgaca
ggggaagtccggatgccttctggaaaaacagcgcgccccaacatcactgacaacaaggat
ggaaccatcacagtgagatacgcaccgacagagaagggcctgcaccagatggggatcaag
tacgacggcaaccatatccctgggagccctctgcagttctatgtggatgccatcaacagc
cgccatgtcagtgcctacgggccaggcctgagccatggcatggtcaacaagcctgccacc
ttcacaattgtcaccaaggatgctggggaaggggggctgtcactggctgtggagggccca
tccaaggcggagatcacctgcaaggacaacaaggatggcacctgtacagtgtcctacctg
cccacagcacccggagactacagcatcatcgtgcgctttgacgacaagcacatcccaggg
agccccttcacggccaagatcacaggtgacgactcaatgagaacatcacagcttaatgtg
ggcacctccaccgatgtgtcactgaagatcacggagggtgacctcagccagctgacagcc
agcatccgtgctccttcaggcaatgaagagccatgcctgctgaagcgcctgcccaacagg
cacattgggatctcctttacccccaaggaggtcggtgagcacgtggtgagcgtgcgcaag
agtggcaagcacgtcaccaacagcccctttaagattttggtggggccttcggagatcggg
gatgccagcaaagttcgagtctggggcaaaggcctttccgagggacaaaccttccaagtg
gcagagttcattgtggacactcgcaatgcaggttatggaggcctggggctgagcatcgaa
ggccctagcaaggtggacattaactgtgaggatatggaagacggtacctgcaaagtcacc
tactgcccgactgaacccggcacctacatcatcaatattaagtttgctgacaagcacgta
cctggaagccccttcaccgtgaaggtgactggcgagggacgcatgaaggaaagcatcact
cggcgcagacaggcaccctccattgccaccattggtagcacctgtgacctcaacctcaag
atcccaggaaactggtttcagatggtgtctgcccaggagcgcctgactcgcaccttcacg
cggagcagtcatacgtacacccgcacagagcggacagagatcagcaagactcggggtggg
gagaccaagcgtgaagtccgagtggaggagtccacccaggtcggcggagaccctttccct
gctgttttcggcgattttctaggccgggaacgcctgggctccttcggcagcatcacccgg
cagcaggaaggtgaggccagctctcaggacatgacagcccaggtgacaagtccgtctggc
aagacagaagccgcagagatcgttgagggagaagacagcgcatacagtgtgcgattcgtg
ccccaggagatgggtccccacacagtcactgtcaagtaccgcggccaacacgtgcccgga
agcccttttcagttcactgtgggtccgctaggtgaaggtggtgcccacaaggtgcgagct
ggaggcacagggctggagcgaggtgtagctggtgtgccagctgagtttagcatctggacc
cgagaagctggtgctgggggattgtccatcgctgtggaaggtcccagcaaggcagagatt
gcatttgaggaccgcaaagatggttcttgtggcgtctcctatgttgtccaggagccaggt
gactacgaggtctccatcaagttcaatgatgagcacatcccagacagcccgttcgtggtg
cccgtggcctccctctcagacgacgctcgccgcctcactgttaccagcctccaggagaca
gggcttaaagtgaaccagccagcatctttcgcggtgcagcttaatggggcacgtggtgtg
attgatgcccgggtacacacaccctcaggagctgtggaggagtgctatgtctctgaactg
gacagtgataagcataccatccgcttcatcccccatgagaacggtgtccactcaattgat
gtcaagttcaacggcgcccacatccctggaagtcccttcaagatccgtgttggggagcag
agccaggctggggacccaggcttggtgtcagcttatgggcctgggcttgaaggaggcact
acgggcgtatcatcagagtttattgtgaacacccagaatgcaggctcaggggctttgtct
gtcaccattgatgggccttccaaggtgcagctggactgtcgggaatgtcccgagggccat
gtagtcacttacactcccatggctcctggtaactacctcattgctatcaagtatggtggc
cctcagcacattgtgggcagtcccttcaaagcaaaggtcacaggtccccggttgtctgga
ggccacagccttcacgaaacatccacagttctggtggagacggtgaccaagtcctcctcg
agccgcggtgccagttacagttccatccccaagttctcctcggatgccagcaaggtggta
acaaggggccctggtctgtcccaggcctttgtgggtcagaagaactcattcaccgtggac
tgcagcaaagcaggcaccaacatgatgatggtgggcgtgcatgggcccaagaccccctgc
gaagaggtatatgtgaagcacatgggaaaccgggtctacaacgtcacctacactgtcaag
gagaagggagactacatcctcattgtcaagtggggtgatgaaagtgtccctgggagcccc
ttcaaggtcaatgtgccctga

DBGET integrated database retrieval system