KEGG   Mus musculus (mouse): 192187
Entry
192187            CDS       T01002                                 

Gene name
Stab1, FEEL-1, FELE-1, MFEEL-1, MS-1, STAB-1, mKIAA0246
Definition
(RefSeq) stabilin 1
  KO
K19020  stabilin-1
Organism
mmu  Mus musculus (mouse)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mmu00536]
    192187 (Stab1)
Glycosaminoglycan binding proteins [BR:mmu00536]
 Hyaluronan
  Cell surface receptors
   192187 (Stab1)
SSDB
Motif
Pfam: Fasciclin EGF_3 Xlink FXa_inhibition EGF_MSP1_1 Laminin_EGF EGF
Other DBs
NCBI-GeneID: 192187
NCBI-ProteinID: NP_619613
MGI: 2178742
Ensembl: ENSMUSG00000042286
Vega: OTTMUSG00000033286
UniProt: G3X973
Position
14; 14 B
AA seq 2571 aa
MAEPRTLLLLCVLVLCLSDSSFIRGQTVRSKRCDIHTKFVTHTPCTACAAIRRQLCPWGW
SRNFPEKILLDCRYELQLRGAAISLSGCSQECWKDVVQKACCPGYWGSQCFECPGGPATP
CSGHGTCLDGIEGNGTCVCQENFSGSVCQECRDPNRFGPDCQSVCNCVHGVCSHGPRGDG
SCRCFAGYTGPHCDQELPVCQSLKCPQNSQCSAEAPTCKCLPGYTQQDNVCLAPDPCQPS
ACSPLARCSVTPQGQAQCQCPENYHGDGKVCLPRDPCLTNFGGCPSNSTFCLYRGPGKAT
CMCRPGMTSINNNASEGCHVSCKPHSCDRSATCQVTPDRKTSCVCKNDEVGDGHACYGHL
LHEVRRANQNGLVFLRLRAAIAMLEQGCQEILTTSGPFTVLVPSMFSVSSVSSNMNATLA
QQLCRQHVIAGEHMLENAGPPSTRRWWTLAGQEVTITFKNMRYAYKYEDQPQQFSIHKAN
YIAANGVFHTVTALRWQLPPPLPGDSKKTVGQILASTEVFTRFETILENCGLPSILDGPG
PFTVFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLISKGRVLTMA
NQVLTVNISEEGRILLGPEGIPVRRVDVPAANGVIHMLEGILLPPTILPILPKHCDEEQH
QTVLGSCVDCQALNTSVCPPNSVKMDIFPKECVYIHDPNGLNVLKKGCADYCNQTITKRG
CCKGFFGPDCTQCPGGFSNPCYGKGNCSDGVRGNGACLCFPDYKGIACHICSDPKKHGEQ
CQEDCGCVHGLCDNRPGSGGVCQQGTCAPGFQGRFCNESMGNCGSTGLAQPCHSDAHCVI
QEGVARCVCHDGFEGNGFSCKRSNPCSRPDRGGCSENAECVPGDLGTHHCICHKGWSGDG
RICVAIDECGLDTRGGCHADALCSYVGPGQSRCTCKLGFAGNGYECSPIDPCRVGNGGCH
GLATCKAVGGGQRVCTCPPHFGGDGFSCYGDIIQELEANAHFSAFSQWFKNSSITLPADS
RVTALVPSESAIRRLSLEDQAFWLQPKMLPELARAHFLQGAFSEEELARLNGQQVATLSA
TTRWQIHNISGKVWVQNATVDVPDLLATNGILHIVSQVLLPPRGDMQTGPGLLQQLDSVP
AFRLFGEQLKHHKLVAQIEAAKAYTIFVPTNHSLETQGNNSVLGIDTVRHHVILGEALSV
EVLRKGGHRNSLLGPAHWLVFYNHSGQPEVNHMPLEGPLLEAPGSSLFGLSGILAVGSSR
CLHSHAEALREKCINCTRKFRCTQGFQLQDTPRKSCVYRSGLSFSRGCSYTCAKKIQVPD
CCPGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGNGECRCQEGFHGTACEMCELGRYGPTC
SGVCDCDHGLCQEGLRGNGSCVCHAGWQGLRCDQKITDHQCPKKCDPNANCIQDSAGIPA
CVCAAGYSGNGSYCSEVDPCASGHGGCSPYANCTKVAPGQRTCTCQDGYTGDGELCQEIN
SCLVHNGGCHVHAECIPTGPQQVSCSCREGYSGDGIQTCKLLDPCSQNNGGCSPYAVCKS
TGDGQRTCSCDATHTVGDGITCHGRVGLELLRNKYASFFSLHLLEYKELKGDGPFTVFVP
HADLISNMSQDELARIRAHRQLVFRYHVVGCRKLWSQEMLDQGYITTLSGHTLRVSEREG
SIYLNDFARVVSSDLEVVNGVLHFIDHVLLPPDVLHWESGAIPIPQRNVTAAAESFGYKI
FSRLLTVAGLLPMLQDASHRPFTMLWPTDSALQALPPDRKNWLFHEDHRDKLAAILRGHM
IRNIEALASDLPNLGQLRTMHGNTISFSCGLTRPGELIVGEDEAHIVQRHLTFEGGLAYG
IDQLLEPPDLGARCDRFEPQPLQMKTCSICGLEPPCPRGSREQGSPETCWRHYSKFWTTP
LHSISMRGAYWIPSSFWNRNHMSRGCHRNCVTTVWKPSCCPGHYGINCHACPGGPRSPCS
DHGVCLDGIRGSGQCNCHPGFAGTACELCAPGAFGPQCQACRCTQHGRCDEGLGGSGSCF
CDEGWTGARCEVQLELQPVCTPPCAPQAVCRLGNSCECSLGYEGDGRVCTVADLCQKGHG
GCSKHANCSQVGTVVTCTCLPDYEGDGWSCRARDPCLDGHRGGCSEHADCLNTGPNTRRC
ECHVGYVGDGLQCLEELEPPVDRCLGGSSPCHTDALCTDLHFQEKQAGVFHIQATSGPYG
LTFSEAKEACEGQGAVLASLPQLSAAQQLGFHVCFVGWLANGSAAHPVVTPAADCGNNRV
GVVSLGVRKNLSELWDAYCYRVQDVACQCRAGFVGDGISTCNGKLLDVLAATANFSTFYG
MLLGYANATQRGLEFMDFLEDELTYKTLFVPVNKGFVDNMTLSGPDLELHASNATFLSIN
ASRGTLLPAHSGLSLFISDTGPDNTSLVPLAPGAVVVSHVIVWDIMAFNGIIHALASPLL
MPPQTRAVLGSEPPPVALSLGVVVTSGTLLGLVAGALYLRARGKPPGFSFSAFQAEDNAD
DDFSPWQEGTSPTLVSVPNPVFGSSDIFCEPFDDSVLEEDFPDTQRVLKVK
NT seq 7716 nt   +upstreamnt  +downstreamnt
atggcagagccccgaaccctccttctgctctgtgtcctggtcctctgcctgtcagactcc
agcttcatccgagggcagacggtacggtctaaacgttgcgacatccacaccaagtttgtc
actcacacaccctgtacggcgtgtgcagctatcaggaggcaactatgtccctggggctgg
tctcggaatttcccagagaagatacttctggactgccgctatgagttgcagctcaggggc
gccgcgatatccttaagtggctgcagccaggaatgctggaaggatgtggttcagaaggcc
tgctgccccggctactggggatcccagtgctttgagtgccctggtggtccggcgacaccg
tgtagtggccacgggacctgcctggatggcatagaaggaaacgggacctgtgtgtgccag
gaaaacttcagcggttcagtctgccaggagtgccgagaccccaacagatttgggcctgac
tgccaatcagtgtgcaactgcgtacatggcgtgtgtagccatgggccacggggagatgga
agctgccggtgttttgctgggtatactggcccccactgtgaccaagagctcccagtctgc
cagagtctgaaatgcccccagaattcccagtgctctgcagaggcacccacctgcaagtgc
ctgcccggatacactcagcaagacaatgtttgtcttgctcctgacccctgccagccatct
gcttgctccccactggcccgatgctcagtgactccccaggggcaggctcagtgccagtgc
ccagagaattaccacggagatgggaaagtgtgtctgccccgggacccttgcctcaccaac
tttggtggctgccccagcaactctaccttctgcctgtaccgtgggccaggcaaggccacc
tgtatgtgccgaccaggtatgacaagcattaacaacaacgcttctgaggggtgccatgtc
tcctgcaaaccacattcctgcgacagatcagctacctgtcaggtgacccctgacagaaag
accagctgcgtgtgcaaaaacgacgaggtgggtgacggtcatgcctgctatggacatcta
ctccatgaggttcggagggccaatcagaatggcctggtgttcctgcggttaagagcagcc
attgccatgctggagcagggctgccaggagattcttaccacgtcggggccattcaccgtt
ctggtgccatccatgttctctgtctcctctgtctccagtaacatgaatgcgacgctggct
cagcagctctgccgacagcatgtcatcgcaggggagcacatgctggagaatgcagggccc
ccaagcacacgcaggtggtggacgctggctggccaggaggtcaccatcactttcaaaaac
atgagatatgcctacaagtacgaagatcagccccagcagttcagcatccacaaggccaac
tacatcgcagctaatggggtcttccatacggtcactgctctacgatggcagcttccaccc
ccacttccaggggactccaagaaaactgttggccagatacttgcttctacagaagttttc
acacggtttgaaacgatcctggagaactgtgggctgccatctatcctggatgggcctggg
cccttcacagtctttgccccgagcaacgaagctgtggacagcctgcgagatggccgactg
atctaccttttcacagcaggcctttccaaacttcaggagctggtacggtaccacatctac
aaccatggtcagctgacagttgagaagctcatctctaaaggacgtgtcctcaccatggcc
aaccaggtcctgactgtgaatatctctgaggagggacgcatcctgctgggaccggagggc
atccctgtgcggagggtcgatgtgccggctgccaacggtgtgatccacatgctggaaggc
atcctgctgccccccaccattttgcctatcttacctaagcactgtgatgaagagcagcac
cagactgtgctgggttcttgtgtggattgccaagccttgaacaccagtgtatgcccccca
aacagcgtgaaaatggatatcttccccaaggagtgcgtttatatccacgacccaaatggg
ctcaacgttctgaagaaaggctgtgctgactactgcaaccagaccatcacaaaacgcggt
tgctgcaaaggattttttgggcctgactgcacacagtgtcctgggggcttctccaacccc
tgctacggcaaaggcaactgcagcgatggggtccggggcaatggagcctgcctctgcttt
ccagactacaagggtatcgcctgtcatatctgctccgacccaaagaagcatggagagcag
tgccaggaggactgtggctgtgtccacggtctgtgtgacaaccgtcctggcagtggaggg
gtgtgccagcagggtacatgtgcccctggcttccaaggccgattctgcaatgaatccatg
ggaaactgtgggtccacagggctggcccagccctgccactcggacgctcactgtgttatc
caggagggtgttgccaggtgcgtctgccatgatggttttgaaggtaatggcttctcctgc
aaacgcagcaatccttgctcgcgcccagaccgtggtggctgctcagagaacgctgaatgt
gtccctggagacctgggtacccaccactgcatttgccacaaaggctggagtggggatggc
cgcatctgtgtggccatcgatgaatgtgggctggacactcgaggtggctgccatgctgat
gctctctgcagctatgtgggccctggacagagccgatgcacgtgtaagctgggcttcgct
ggaaatggctacgagtgcagccccattgacccctgtcgggtgggcaatggcggctgccac
ggcctggctacctgcaaagcagtggggggaggccagcgggtttgcacatgccctcctcat
tttggtggtgatggcttcagttgctatggagatattatccaggaactggaggcaaatgcc
catttctctgccttctcccagtggttcaagaattcaagcatcactcttcctgccgacagc
agagtcacagccctggtaccctctgagtccgccatccgtagactgagcctcgaggaccag
gccttctggttgcagccaaagatgctgccagaactggccagggcccattttctccagggt
gccttctcagaggaggagttggcccggttaaatggtcaacaagtagccacactgagtgcc
acgacacgctggcagatacacaacatcagtgggaaagtctgggtgcagaatgccactgtg
gatgtccccgacctccttgctaccaatggcatcctacacattgttagccaggtcttgttg
cctccaagaggtgacatgcagaccgggcccgggttgctgcagcaactagatagtgtgcct
gcctttcgcctcttcggagagcagctaaagcaccacaaactggtggcccaaatcgaggct
gccaaagcctacaccatctttgtgcccacaaatcactctctggagacccagggcaacaac
agtgtcctgggtatagacacggtgcgacatcacgtgatccttggggaggcactctctgtg
gaggtcctgcggaaagggggacaccgcaactccctcctgggccctgcccactggctggtc
ttctacaatcacagtggccagcctgaggtgaatcacatgccattggagggccctttgctg
gaagctcctggcagctccctcttcggactgtcggggatcttggcagtgggctccagccgt
tgcctgcacagccacgcagaggctcttcgggagaaatgcataaactgtacccggaaattc
cgctgtactcaaggcttccagctgcaggacacaccgaggaagagctgtgtctacagatct
ggattgtctttctcccggggctgttcctacacctgtgccaagaagatccaggtgcccgac
tgctgcccaggcttctttggtaccctgtgtgagccctgcccagggggtcttggtggagtg
tgctcaggccatgggcagtgccaagacagattcctgggcaatggggaatgtcgctgccaa
gaggggttccatgggacagcctgtgagatgtgtgagctgggtcgctatggccccacctgc
tctggagtatgtgactgtgaccatgggctgtgccaggaggggctgcgcgggaatggaagc
tgtgtctgtcatgcgggctggcagggtctccgctgtgaccagaaaatcactgatcatcaa
tgtcccaagaagtgcgatcccaatgccaactgcatccaggactctgctggaatccctgcc
tgcgtctgtgctgcaggatactcgggcaacggcagctattgctcagaggtggatccctgt
gcctctggccatgggggctgctcaccctatgccaactgtaccaaggtggctcctgggcag
cggacatgcacctgccaggatggctacacgggcgatggagagctatgccaggaaataaac
agctgtctcgtccacaatgggggctgtcatgttcatgctgagtgtatccccacaggcccc
cagcaggtctcctgcagctgccgtgagggctacagtggcgatggcattcagacttgcaag
cttctggacccctgttcccagaacaatggaggctgcagtccttatgctgtgtgcaaaagc
acgggagatggccagaggacgtgttcctgtgacgcaacacatactgtgggggacggcatc
acctgtcatgggagagttggactggagctcctacggaacaagtatgcctccttcttcagc
ctccacctcctggaatacaaggagctcaagggtgacggacctttcactgtctttgtgcca
catgctgacttaataagcaacatgtcacaggatgagctggctaggatacgggcccatcgc
cagcttgtgtttcgctaccacgtggttggctgccggaagctgtggagccaagagatgctg
gaccagggctatatcactacactgtctggacacactctgcgtgttagtgagagggagggc
agcatttatctcaatgattttgctcgggtggtaagcagcgatctcgaggtggtgaacggt
gtcctgcacttcattgaccacgtcctgctgccaccagatgtgctacactgggagtctggt
gctatcccaatccctcagagaaatgtcactgccgctgctgaaagcttcggctacaagatc
ttcagccgcctattgacggtggctggcctcctgcccatgcttcaggatgcgtcccatcgc
cccttcacgatgctgtggcccacagattctgccctgcaagccttgcctcctgatagaaag
aactggctcttccacgaggaccaccgtgacaaactggcagccattttgcggggtcatatg
attcgcaacattgaggccttggcgtctgacctacccaacctgggccaactccgaaccatg
cacggaaacaccatctctttctcctgcggtctcacccggcctggtgagctcatagtaggc
gaagacgaggcccacattgtgcaacggcacttgacctttgaaggtggcctggcttatggc
attgaccagctgctggagccacctgaccttggcgcccgctgtgatcgctttgaacctcag
ccactccaaatgaagacttgcagcatctgtgggctggagccaccctgtcctcggggctca
cgggagcagggcagccctgagacctgctggcgtcactactccaagttctggacaactcca
ttgcactccatctcaatgcgtggagcttactggataccgtctagtttttggaatcgtaac
cacatgagtaggggctgccaccgaaactgtgtcaccaccgtctggaagcccagctgttgc
cctggtcactatggcattaactgccatgcttgccctggtggccccagaagcccctgcagt
gaccatggcgtgtgcctggatggtatacgtggaagtgggcagtgtaattgccatccgggt
tttgctgggacagcctgtgaactctgtgccccaggtgcctttggaccccagtgccaagct
tgccgctgtacccaacatggccgttgtgatgaaggtcttgggggctctggctcctgcttc
tgcgatgaaggctggactggggcacgctgtgaagtgcagctggagttgcagcctgtgtgc
accccaccgtgtgcaccccaggccgtgtgccgtctgggcaacagctgtgagtgcagcctg
ggctatgaaggggatggccgtgtgtgcacagtggcagacctgtgccagaaggggcatggt
ggctgcagtaagcatgccaactgcagccaggtggggacagtggtcacttgcacctgcctg
cctgactatgagggtgacggttggagctgccgagctcgagacccctgcttggatggccac
cgtggaggttgcagcgagcacgctgactgcctcaataccggtccgaacacacggcgctgt
gaatgccacgtaggctacgtgggtgatgggctgcagtgtctagaggagcttgaaccccct
gtggacagatgcttgggaggatcatcaccttgccacactgatgctttgtgcactgaccta
catttccaggaaaaacaggctggtgtcttccacatccaggccaccagtggcccttatggt
ctgaccttctcagaggccaaggaagcgtgtgagggccagggagccgtccttgcttcactc
cctcaactctctgccgcccaacagctaggttttcatgtctgcttcgtgggctggttggcc
aacggctctgctgcccaccctgtcgtcaccccagcggcagactgtggtaataatcgtgta
ggtgtagttagccttggggtccgtaagaacctctcggagctctgggatgcctactgttac
cgcgtgcaagacgtggcttgccagtgtcgggccggcttcgtgggtgacgggatcagcacg
tgcaacgggaaactgcttgatgtcttggccgccactgccaacttctccaccttctatggg
atgctgctgggctatgccaatgccacccagagaggtcttgaatttatggatttcctggag
gacgagctcacctacaagacactcttcgttcctgtcaacaaaggctttgtggacaacatg
acgctgagtggcccagatctagaactccacgcttctaacgccacctttctgagtatcaat
gccagccgggggacattgcttcctgcccactcaggtcttagcctcttcataagtgacacg
ggccctgacaacacttctctggttcctctggccccgggggcagttgtggttagccacgtc
atcgtgtgggacatcatggctttcaacggcatcattcatgctctggccagccccctgctc
atgcctccccagactagggcagtgctgggatctgagcctccacctgtggcattaagcttg
ggggttgtggtaacttctggaacactgctggggctggtggcgggagctctctacctgcgt
gcccgaggcaaacctccaggtttcagcttctctgcctttcaggcagaagataatgcagac
gatgacttctccccatggcaagaagggaccagcccaaccctggtttctgtccccaaccct
gtttttggcagcagtgacatcttttgtgaaccctttgatgattcagtcctggaggaggac
ttccccgacacccagagggtcctcaaggtcaaatga

DBGET integrated database retrieval system